SecReT4
Protein ID: 116687183
T4SS name [ID]Tra_F [516]
Gene symbol-
Locus tagBcen2424_6807
StrainBurkholderia cenocepacia HI2424
Repliconplasmid 1 [GenBank: NC_008545] [Browse all T4SS(s) in this replicon]
Location [Strand]16139..16927 [+]
Producthypothetical protein
Component typeTrbC_F
UniProt IDA0B4P2
KEGG IDbch:Bcen2424_6807
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 9.1e-30, Aligned region: 131..240
Protein Sequence: 262 a.a.     [Download]
>gi|116687183|ref|YP_840429.1| hypothetical protein Bcen2424_6807 [Burkholderia cenocepacia HI2424]
MSRLTFSIVAAGTIALAAVHVSAQTVSNHALAREQQQINTTRRATFDEAASGTARYRGVMPSSDAIDAEM
SRIQGSRDRQMAQAAAKAAHDGNAFPNLPTPAPAAAGADPFAVAKRYESRTQRRVTDSFVAFASFSMPAA
SLVRLVKTMNQAGGTVVFRGFKNDSLKATAAEMQRLGIASGGIVVNPKAFTQYRIARVPAYVVTRGGDAN
NQVDSSGCALPASYVSLSGDVTPAYALRQIVDHSPTYGGIAERYLRALGDVE
 
Nucleotide Sequence: 789 bp     [Download]
>gi|116687164|ref|NC_008545.1|:16139-16927 Burkholderia cenocepacia HI2424 plasmid 1, complete sequence
ATGAGTCGGCTCACTTTCTCCATCGTAGCCGCCGGCACGATCGCCCTCGCGGCCGTTCACGTGTCGGCAC
AAACCGTGTCGAATCACGCGCTCGCGCGTGAGCAGCAACAGATCAATACCACGCGCCGAGCGACCTTCGA
TGAGGCAGCCAGCGGCACCGCGCGTTACCGCGGCGTGATGCCATCGTCGGATGCGATTGATGCCGAGATG
AGCCGTATCCAGGGCAGTCGCGATCGGCAGATGGCCCAGGCTGCAGCAAAGGCAGCTCACGATGGCAACG
CGTTCCCGAACCTGCCGACGCCGGCGCCAGCCGCCGCCGGTGCCGACCCGTTCGCCGTCGCCAAACGGTA
CGAAAGCCGTACGCAGCGTCGTGTGACCGATTCCTTCGTCGCGTTCGCGAGCTTCTCGATGCCCGCTGCC
TCGCTGGTACGCCTGGTGAAGACCATGAATCAGGCCGGCGGAACTGTGGTGTTCCGGGGCTTCAAGAACG
ACTCACTGAAGGCGACGGCCGCGGAAATGCAGAGGCTGGGGATTGCGTCCGGCGGCATCGTCGTCAACCC
GAAGGCGTTCACGCAGTATCGCATCGCCCGTGTGCCCGCCTATGTCGTCACACGCGGTGGAGACGCCAAC
AATCAGGTTGACAGCAGCGGATGTGCGCTGCCGGCGTCGTACGTCTCCTTGTCGGGAGACGTGACGCCCG
CGTATGCCCTGCGCCAGATCGTCGATCACAGCCCTACCTACGGGGGGATCGCCGAGCGATATCTCCGTGC
ACTGGGGGATGTCGAATGA
 Primer design