SecReT4
Protein ID: 116687185
T4SS name [ID]Tra_F [516]
Gene symbol-
Locus tagBcen2424_6809
StrainBurkholderia cenocepacia HI2424
Repliconplasmid 1 [GenBank: NC_008545] [Browse all T4SS(s) in this replicon]
Location [Strand]18210..19490 [+]
Productconjugal transfer mating pair stabilization protein TraN
Component typeTraN_F
UniProt IDA0B4P4
KEGG IDbch:Bcen2424_6809
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 4.7e-35, Aligned region: 35..204
TraN [PF06986], Evalue: 4.7e-35, Aligned region: 309..373
Protein Sequence: 426 a.a.     [Download]
>gi|116687185|ref|YP_840431.1| conjugal transfer mating pair stabilization protein TraN [Burkholderia cenocepacia HI2424]
MNIRALMFAARAFTLVGSVMTVTLLAAPVAYAAPTCQRTGSACIEPAGTRVINGIPLYQDCWNYQDTYEC
QAASTVNDCTPLQQQGCGLVNQQCVSYNDAVQGSCDTMQYTYQCLDTPAHTTTVTQCTNTMCAPGAGCFS
SSSGADGALGKVVAGLETGREAGAYGVGGGNVNIFKGYDSSCSIKVLGGLEIKSCCTSNGGGAAYSNNAI
GSAAVSAGLSVGGTAAKQGIALGSKYVFDQLYETVDSSIVNSGLLQMGAWADRALSTSGTFGAYGFSFSF
SLTNGVQLADFNPYVFAAEIAAQLIQMWLACSPDEQVLSLKRGQNLCVQYNQGCSKRVLGVCVEEKKSYC
CFNSLIAKLVNQQGKAQLGIPFAGCGGFTADQLQRIDFSNIDFTEFVNSIQSKAVDEDAILQRVRQSIGS
GKGVSQ
 
Nucleotide Sequence: 1281 bp     [Download]
>gi|116687164|ref|NC_008545.1|:18210-19490 Burkholderia cenocepacia HI2424 plasmid 1, complete sequence
ATGAATATCCGCGCTCTCATGTTCGCCGCGCGTGCGTTCACCCTCGTCGGCAGTGTAATGACGGTCACCC
TGCTCGCCGCGCCGGTAGCGTATGCCGCGCCCACCTGCCAACGCACTGGTTCAGCCTGCATCGAGCCGGC
CGGCACACGTGTCATCAACGGGATTCCGCTCTACCAGGATTGCTGGAACTACCAGGATACCTACGAATGC
CAAGCCGCTTCCACCGTTAACGACTGCACGCCATTGCAGCAGCAAGGCTGCGGCCTTGTGAACCAGCAGT
GTGTGTCATACAACGACGCGGTGCAGGGAAGCTGCGACACGATGCAGTACACGTACCAGTGTCTCGATAC
TCCGGCGCACACGACGACCGTCACCCAATGCACGAACACGATGTGCGCACCGGGTGCCGGATGCTTCTCG
TCAAGCAGTGGTGCGGACGGCGCGCTCGGCAAGGTCGTAGCAGGGCTGGAAACCGGGCGCGAAGCCGGCG
CCTACGGTGTCGGTGGCGGTAACGTGAACATTTTCAAAGGCTACGACAGCAGCTGCTCGATCAAGGTGCT
GGGCGGCCTCGAGATCAAGAGCTGCTGCACCAGCAACGGCGGCGGCGCCGCTTACTCGAACAACGCGATC
GGAAGCGCCGCGGTCAGCGCTGGACTGTCGGTTGGCGGAACGGCGGCGAAGCAGGGCATCGCGTTAGGGT
CGAAGTATGTCTTTGACCAGCTGTACGAAACGGTCGATAGCTCGATCGTGAACTCTGGTCTCTTGCAGAT
GGGCGCATGGGCGGACAGGGCGTTGTCTACCTCCGGAACCTTTGGTGCCTACGGCTTTAGTTTTTCGTTC
TCCCTCACCAATGGTGTTCAGCTTGCAGATTTCAATCCGTACGTATTCGCGGCCGAGATCGCTGCGCAGC
TGATCCAGATGTGGCTCGCATGTTCCCCTGACGAGCAGGTGCTCAGTCTGAAGCGTGGCCAGAACCTCTG
TGTCCAGTACAACCAGGGCTGCTCCAAGCGCGTGCTCGGCGTGTGCGTCGAGGAAAAGAAGAGCTACTGC
TGTTTCAACTCGTTGATCGCGAAGCTTGTCAACCAGCAAGGCAAGGCGCAACTCGGCATCCCCTTCGCCG
GCTGCGGTGGCTTCACGGCCGACCAACTCCAGCGTATCGATTTTTCGAATATCGACTTTACCGAGTTCGT
CAATTCGATCCAGTCCAAGGCCGTCGACGAGGACGCGATTCTGCAGCGCGTGCGGCAATCGATCGGAAGC
GGAAAAGGGGTATCCCAATGA
 Primer design