SecReT4
Protein ID: 116687189
T4SS name [ID]Tra_F [516]
Gene symbol-
Locus tagBcen2424_6813
StrainBurkholderia cenocepacia HI2424
Repliconplasmid 1 [GenBank: NC_008545] [Browse all T4SS(s) in this replicon]
Location [Strand]21393..22202 [+]
Producthypothetical protein
Component typeTraF_F
UniProt IDA0B4P8
KEGG IDbch:Bcen2424_6813
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 4e-73, Aligned region: 44..258
Thioredoxin_2 [PF13098], Evalue: 6.5e-05, Aligned region: 163..253
Protein Sequence: 269 a.a.     [Download]
>gi|116687189|ref|YP_840435.1| hypothetical protein Bcen2424_6813 [Burkholderia cenocepacia HI2424]
MSAFRGFGLAVAVLLPAALLVSPIAHADGLDYKSAWSCDGQEKFNWYCDDDKPAAPAGASAAKPTDSDDF
DQIKSADEMREALKHRLDVANMDPTPEHIKEYIKLWEYVQQKSAVFADQWRRVVWQNPSLDYSLKRPTNN
VAVHTYDRTRDSDQDGQLRALAQKHGLIFFFRSDCPYCHAMAPTIVLLAQRYGIDVLPVSLDGRGIGEFP
NPTPDHGQASVWGVQQVPALFIASKETGDHAMIGSGTMSLQDIIDRIFVLTASQPGELF
 
Nucleotide Sequence: 810 bp     [Download]
>gi|116687164|ref|NC_008545.1|:21393-22202 Burkholderia cenocepacia HI2424 plasmid 1, complete sequence
ATGAGCGCATTCCGTGGATTCGGGCTCGCGGTAGCGGTCCTGCTTCCTGCAGCGCTACTGGTGTCGCCGA
TCGCACACGCCGATGGGTTGGACTACAAGTCCGCCTGGAGCTGCGACGGGCAGGAGAAATTCAATTGGTA
CTGCGACGACGACAAGCCTGCGGCGCCGGCAGGTGCGAGCGCGGCCAAGCCAACCGATTCCGACGACTTC
GACCAGATCAAGTCCGCCGATGAGATGCGCGAGGCGCTGAAGCACCGACTCGACGTCGCGAACATGGACC
CGACGCCCGAGCACATCAAGGAGTACATCAAGCTCTGGGAGTACGTCCAGCAAAAGAGCGCTGTCTTCGC
CGATCAATGGCGCCGCGTCGTATGGCAGAACCCGAGCCTCGATTACTCGCTCAAGCGTCCGACCAACAAC
GTCGCTGTCCATACCTACGACCGGACCCGGGATTCCGACCAGGACGGGCAGCTACGTGCGCTCGCGCAGA
AGCACGGCCTGATTTTCTTCTTCCGCTCGGACTGCCCGTACTGCCATGCGATGGCCCCGACGATTGTGCT
GCTCGCGCAGCGCTATGGCATTGACGTGCTGCCGGTCTCTCTGGACGGGCGAGGCATTGGCGAGTTTCCG
AACCCGACGCCTGACCACGGGCAGGCGTCGGTCTGGGGCGTCCAGCAGGTGCCCGCCCTCTTCATCGCGT
CGAAAGAGACCGGCGACCACGCGATGATCGGCTCGGGAACGATGTCCCTCCAGGACATCATCGACCGAAT
CTTCGTTCTCACTGCCTCGCAGCCTGGGGAGCTTTTCTGA
 Primer design