SecReT4
Protein ID: 116687190
T4SS name [ID]Tra_F [516]
Gene symbol-
Locus tagBcen2424_6814
StrainBurkholderia cenocepacia HI2424
Repliconplasmid 1 [GenBank: NC_008545] [Browse all T4SS(s) in this replicon]
Location [Strand]22202..23647 [+]
ProductTraH family protein
Component typeTraH_F
UniProt IDA0B4P9
KEGG IDbch:Bcen2424_6814
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 1.2e-107, Aligned region: 27..389
Protein Sequence: 481 a.a.     [Download]
>gi|116687190|ref|YP_840436.1| TraH family protein [Burkholderia cenocepacia HI2424]
MKPTRWIVAMTAAVFAIAPVCTQAMSMQQVFDSINAMGNVSSPRALQGETMDMYSGGSVFMRTPHKTYQL
ASVTAPEWGAGCGGIDLFTGGFSFINKEQFVALLRNIGSNALGYAFKLALQNLCPTCDNVMQSLQAIARD
VNRMNIDSCQAAEGIVNAVTPVAWKKEQANLADTLGPFTNLYSDMTDAWTNTGNSSAQAAQTINTATASD
SNLAAKQPYGNVTWQALQQLPDLSTSDREFLMSLVGTVIFPAPSDSGGTEVNPVFLPRIGSLTVQELVGN
DPAANSGTTIQVYVCDETTKCLNPSVQEIGYTPFRTLVQQKLQVITDAIASRSAIPNPADTFRFLSMTDL
PVYKMIAVGTRLNNSSLADQLLSTYQSLIAAKYAEAYIHGSAEDLRRAIARYGTVKSSTSLLDEATKLNT
NIDTVESEARSVVMQAFSQTSNAWQLVEQLQSIERAVHANVSSSLRNSLAFGQTLNGGSTQ
 
Nucleotide Sequence: 1446 bp     [Download]
>gi|116687164|ref|NC_008545.1|:22202-23647 Burkholderia cenocepacia HI2424 plasmid 1, complete sequence
ATGAAACCGACACGCTGGATTGTCGCAATGACGGCTGCAGTGTTTGCCATCGCCCCGGTCTGTACGCAGG
CGATGTCGATGCAGCAGGTCTTCGACTCTATCAACGCCATGGGCAACGTATCGAGCCCGCGGGCGTTGCA
GGGCGAGACGATGGATATGTACAGCGGCGGAAGCGTGTTCATGCGCACGCCACACAAGACTTACCAGCTC
GCGAGCGTCACGGCCCCGGAATGGGGAGCGGGTTGCGGCGGGATCGACTTGTTCACCGGCGGGTTCAGCT
TCATCAACAAAGAACAATTTGTCGCGCTGCTGCGCAACATCGGCTCGAACGCGTTGGGCTACGCATTCAA
GCTCGCCTTACAGAACCTCTGCCCGACCTGCGACAACGTCATGCAGTCCCTGCAGGCCATCGCGCGCGAC
GTCAACCGGATGAACATCGACTCGTGCCAGGCCGCGGAGGGCATCGTCAATGCGGTGACGCCTGTTGCGT
GGAAAAAAGAGCAGGCAAACCTCGCCGACACGCTCGGGCCATTCACGAACCTGTATTCGGATATGACCGA
TGCCTGGACAAATACCGGAAACAGCTCGGCGCAGGCGGCGCAGACGATCAACACGGCGACTGCGTCGGAT
TCCAATCTCGCGGCCAAGCAGCCGTACGGGAATGTGACGTGGCAGGCACTGCAGCAGCTGCCGGACCTGA
GCACGTCGGATCGCGAATTCCTGATGTCGCTGGTGGGGACGGTCATCTTCCCCGCCCCGTCGGATTCTGG
CGGCACGGAGGTGAATCCTGTATTCCTGCCCCGAATCGGTAGCCTCACGGTGCAGGAGCTCGTCGGTAAC
GATCCCGCTGCGAACAGCGGCACCACGATTCAGGTGTACGTGTGCGACGAGACGACGAAGTGCCTGAATC
CGTCAGTGCAGGAAATTGGATACACCCCCTTCCGTACGCTCGTACAGCAAAAGCTGCAGGTAATCACGGA
TGCGATCGCATCGCGCTCCGCGATCCCGAACCCGGCAGACACGTTTCGGTTCCTGAGCATGACCGACCTG
CCGGTCTACAAAATGATCGCGGTCGGCACGCGCCTGAACAATTCGTCTCTGGCCGACCAACTGTTGAGCA
CCTACCAGTCGCTGATCGCGGCCAAGTACGCCGAGGCCTACATCCACGGATCTGCTGAAGACCTCCGCCG
GGCAATCGCGCGTTACGGCACCGTGAAATCCAGCACGTCGCTGCTCGACGAGGCCACGAAGCTCAATACC
AACATCGACACGGTGGAATCGGAAGCACGCAGCGTCGTGATGCAAGCCTTCAGCCAGACGTCGAACGCGT
GGCAGCTGGTCGAGCAACTCCAGTCGATCGAGCGTGCCGTGCACGCGAATGTGTCGTCTTCGCTTCGGAA
CTCGTTGGCGTTCGGCCAGACGTTGAACGGCGGGAGCACGCAATGA
 Primer design