SecReT4
Protein ID: 116687191
T4SS name [ID]Tra_F [516]
Gene symbol-
Locus tagBcen2424_6815
StrainBurkholderia cenocepacia HI2424
Repliconplasmid 1 [GenBank: NC_008545] [Browse all T4SS(s) in this replicon]
Location [Strand]23644..27585 [+]
ProductTraG domain-containing protein
Component typeTraG_F
UniProt IDA0B4Q0
KEGG IDbch:Bcen2424_6815
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 2.2e-104, Aligned region: 4..466
Protein Sequence: 1313 a.a.     [Download]
>gi|116687191|ref|YP_840437.1| TraG domain-containing protein [Burkholderia cenocepacia HI2424]
MNMEIDTYGNVDTLYFVMQGIASFMGSGTWTGLIRYTLLCGVVIWTIVAIGRKGYEIFRWFAAAMLMTQL
LLLPIENVFITDVNNVQPTREVDHVPAYLAAVAQSFTLISHVLTQSYETIFSVPDTLTLKKGDVGFGISV
LQKVNKAEITDPGLHADLIQFFKECTVYDIQDGAIDPKTIMNGTDPFNTVFTSTSPARYVTTNTLTANPT
TDTCSATGTLLLLRVQDAEQAAEQMYGSEMYPEIADPSMAKAEFVNAIGDSYGFILQSSQNASSALRQAM
FNNVWRQAGAELPAMLNDPARVAEVNALMSSAQAAVATNGSLASMAILAKNTLPTVRNYAEAIIYAVFPL
ILVLCLISGADGAKRILAMYAKTVAWVSIWPMLFAVINGLSLIHLSHEMRSMSLQAGVPFGMAAKFGQTL
LDEQALLGYMVIITPPLAWMLLNFASAGVVGAFSQLSGALTGSAQQIGGQQAQGDENIGNVHMDSSSIDN
ASRNVTSANKYDNTVQSRTGSMNVDTGTGSAFTNFANGLIARTEFQNSLGVSATSQDAFERSLGTDTSTG
VAANRTNSTFAGREQLASSTNSVSSSQERGSSQRLSDDSSSGTRASSSQTGERRTAHDQQYAIDQSHSVD
GTTSAGAKGSIMLGGGFAKSFGEDGAPSGNAGGGGGGSAGGSGRGPSGNGRQGSSNPVSNSPLFNQAEED
KLARKAESLGKSPNEVQAIRDAYRSKVRAADYANGGGTGKGQSSLKFGLDVSGEGGYTKSWRNSDAQKFV
DQNSSLAAYTESDNVSHEGSQMHNDSTGMESGQHVRSDRSASLTDQVSSGSRVAADLTRSADVRQRGSTQ
VVSRVDTSTNLMTPENLQAVAARNGMRYSQLMTLPSPQIAQLVAQDAAMRDIVSRNSTLPTTARDGSTLP
ASGIDVVRQDQRNQSGVGASAPASFRRFAGAVGPVDTTPLDVATPMPQIVTAAQHRVDVTQQRVASESAA
PIKQVRDHVDPSADNKPLMTPERAPGRSLSSPPVAPSASDSKGPLSAWVNSIQPSGPAGTTSTSAPIENF
LRPRTTGNGPTLEAARAAETGTGWPATQPRLSESDFRIVTLPAGNDHMSHRQSDHRVPDAPDVTYSRPSP
ELSSPDQEAVAPPVGSIRGRRVVDDGSRGSSLPTASMKRSGGVSVMAPGTTAGNSGSRVDNVKPANAGQE
QATPAPIAPETVGRRSSTSGGIGLASVGSEVGGVDRKVQIDRTPGGSSAAGDALPPTPSLYLDAATVGAD
ASAPHDDSAVSGAATSPSVLVSASRLGRGSADDARGVKSLPSAGVASDDPDNQ
 
Nucleotide Sequence: 3942 bp     [Download]
>gi|116687164|ref|NC_008545.1|:23644-27585 Burkholderia cenocepacia HI2424 plasmid 1, complete sequence
ATGAACATGGAAATCGACACCTATGGGAACGTCGATACTTTGTACTTCGTCATGCAGGGTATCGCGTCTT
TCATGGGTAGCGGCACCTGGACAGGTCTCATCCGCTACACGCTGTTGTGCGGGGTGGTGATCTGGACGAT
TGTCGCGATCGGTCGGAAAGGCTACGAGATCTTCCGCTGGTTCGCCGCCGCGATGCTGATGACGCAGCTG
CTGTTGCTGCCTATTGAGAACGTGTTCATCACCGACGTCAACAACGTGCAGCCGACTCGGGAGGTGGATC
ACGTCCCCGCGTATCTCGCCGCCGTTGCCCAGAGCTTCACGCTCATCTCTCACGTGCTGACGCAGTCGTA
CGAAACGATCTTTTCGGTGCCGGATACGCTGACCCTGAAAAAGGGCGATGTGGGTTTCGGCATCTCCGTG
CTGCAGAAGGTGAACAAGGCTGAAATCACTGATCCGGGGCTGCACGCCGACCTTATTCAGTTCTTCAAGG
AGTGCACGGTCTACGATATCCAGGACGGCGCAATTGATCCGAAGACGATCATGAACGGCACGGACCCCTT
CAATACCGTGTTCACGTCGACGAGCCCTGCACGATACGTGACGACGAACACCCTTACCGCGAACCCTACG
ACGGACACGTGTTCCGCGACCGGCACTTTGTTGCTGCTGCGCGTACAGGACGCTGAGCAAGCGGCCGAGC
AGATGTATGGCAGCGAGATGTATCCGGAGATCGCCGACCCCTCCATGGCGAAGGCGGAGTTCGTCAACGC
GATCGGAGATTCGTACGGCTTCATCCTCCAGTCGTCGCAGAACGCGTCCTCGGCGCTACGACAGGCAATG
TTCAACAACGTATGGCGTCAGGCGGGCGCGGAGCTGCCCGCGATGCTGAACGATCCGGCGCGCGTGGCAG
AGGTCAATGCGTTGATGAGTTCGGCCCAGGCTGCGGTGGCGACGAACGGTTCGCTTGCCTCCATGGCGAT
TCTGGCCAAGAACACGCTGCCGACTGTTCGCAACTATGCCGAAGCGATTATCTATGCGGTTTTCCCGCTC
ATTCTGGTGCTCTGCTTGATTAGCGGCGCGGATGGGGCCAAGCGAATCCTCGCGATGTACGCGAAGACGG
TGGCGTGGGTATCTATCTGGCCGATGCTCTTCGCGGTCATCAACGGGCTGTCGCTGATCCACCTGAGCCA
TGAGATGCGCTCGATGTCGCTGCAGGCCGGCGTGCCGTTCGGGATGGCGGCGAAGTTCGGGCAGACGTTG
CTCGACGAGCAGGCGCTGCTTGGATACATGGTGATTATTACGCCACCCCTTGCGTGGATGTTGCTGAATT
TCGCGTCGGCCGGCGTTGTCGGTGCGTTTTCTCAACTGAGCGGCGCGCTGACCGGCTCTGCTCAACAGAT
CGGCGGCCAGCAGGCTCAGGGCGACGAAAACATCGGCAACGTGCACATGGATTCGTCGTCGATCGATAAC
GCGTCGCGCAACGTGACCTCGGCGAACAAGTACGACAACACTGTGCAGTCGCGCACCGGGTCGATGAACG
TCGATACCGGGACCGGCTCGGCCTTCACGAACTTTGCAAATGGCCTGATCGCTCGCACCGAGTTTCAGAA
CAGCCTCGGCGTTTCGGCAACCTCCCAGGATGCGTTCGAGCGGTCGCTCGGCACCGACACCTCGACGGGT
GTCGCGGCAAACCGAACGAATTCCACGTTCGCTGGGCGGGAGCAGCTTGCGTCCAGCACGAACAGCGTCT
CGAGCAGCCAGGAGCGTGGAAGCTCACAGCGCCTGTCCGACGATTCCAGCTCGGGTACGCGGGCCTCGTC
TAGCCAAACAGGTGAGCGGCGGACCGCACATGATCAGCAATATGCGATAGATCAGTCACACTCCGTCGAC
GGTACAACTTCTGCAGGAGCCAAAGGTTCGATCATGCTTGGTGGCGGCTTTGCCAAGTCGTTTGGCGAGG
ATGGGGCGCCATCCGGCAACGCCGGCGGTGGAGGCGGCGGCTCAGCCGGTGGTAGCGGGCGTGGGCCTTC
CGGCAATGGTCGGCAAGGAAGTAGCAATCCGGTCTCGAACTCGCCTCTTTTTAACCAAGCAGAAGAAGAC
AAACTCGCTCGCAAGGCCGAGTCACTTGGAAAATCGCCGAACGAAGTTCAAGCGATTCGGGATGCGTATC
GATCGAAGGTGCGGGCTGCGGATTATGCAAATGGCGGCGGCACGGGGAAAGGGCAGTCGAGTCTGAAGTT
TGGTCTCGATGTTTCGGGCGAAGGCGGATATACGAAGTCTTGGCGGAATTCTGACGCACAAAAATTCGTC
GATCAAAACAGTAGTTTGGCCGCCTACACCGAGAGCGATAACGTCTCTCACGAAGGCTCGCAGATGCACA
ACGACTCCACCGGAATGGAGTCCGGGCAGCACGTTCGCAGCGACCGGTCGGCGTCTCTGACGGACCAGGT
TTCGTCCGGCTCCCGCGTTGCAGCGGATCTCACTCGCAGCGCAGACGTGCGCCAGCGCGGATCGACGCAA
GTGGTTTCGCGCGTAGATACCTCGACCAACCTGATGACGCCTGAGAACCTGCAGGCGGTCGCTGCGCGCA
ACGGTATGCGATACAGCCAGCTGATGACGTTGCCGTCCCCGCAGATCGCTCAGCTGGTCGCCCAAGATGC
AGCGATGCGCGACATCGTTTCGCGCAACTCGACGTTGCCGACCACGGCTCGTGATGGGTCTACTCTCCCT
GCGAGCGGCATCGACGTCGTTCGCCAGGACCAACGCAACCAGTCCGGCGTTGGTGCAAGTGCCCCCGCGT
CGTTCCGGCGATTTGCAGGTGCGGTTGGACCAGTGGATACGACACCCCTGGATGTTGCGACGCCGATGCC
CCAAATCGTGACCGCCGCACAGCACCGTGTGGATGTTACGCAGCAACGGGTCGCAAGCGAGTCCGCCGCG
CCGATCAAGCAGGTGCGTGACCACGTCGATCCGTCGGCCGACAACAAGCCGCTCATGACGCCCGAGCGGG
CGCCGGGCCGCTCGCTTTCCTCTCCGCCCGTGGCGCCGTCAGCTTCCGATAGCAAGGGGCCCCTGTCGGC
ATGGGTGAACTCGATTCAGCCGAGCGGGCCGGCTGGAACAACGTCCACCTCGGCACCAATTGAAAACTTC
CTACGTCCGCGAACTACGGGAAATGGCCCGACTCTTGAAGCCGCTCGAGCGGCGGAAACCGGCACGGGCT
GGCCCGCGACTCAACCGCGCCTGTCCGAATCTGACTTCAGGATCGTGACTCTGCCGGCCGGCAATGACCA
CATGTCACATCGGCAGAGTGATCATCGAGTGCCCGATGCTCCTGACGTGACATACAGCCGGCCGTCTCCG
GAGCTATCCAGCCCTGATCAAGAAGCTGTAGCGCCGCCCGTCGGCTCGATACGGGGTCGCCGGGTGGTTG
ACGATGGAAGTCGGGGAAGTAGCTTGCCGACCGCATCAATGAAGCGTAGCGGCGGGGTCTCAGTCATGGC
TCCTGGAACGACGGCTGGCAACTCTGGTTCACGAGTCGACAACGTCAAACCAGCAAACGCTGGTCAGGAG
CAGGCTACGCCGGCGCCTATTGCGCCTGAAACAGTTGGCCGGAGAAGTTCGACGTCCGGTGGCATCGGCC
TCGCAAGCGTCGGGTCAGAAGTCGGTGGCGTCGACAGAAAGGTGCAGATCGATCGCACGCCAGGCGGGTC
ATCTGCTGCAGGGGATGCCTTGCCACCGACACCCTCGCTTTACCTCGATGCCGCAACCGTCGGCGCCGAC
GCATCTGCTCCGCACGACGACTCGGCGGTAAGCGGCGCGGCCACTTCCCCGAGCGTTCTGGTTTCGGCGA
GTCGACTAGGACGCGGTTCTGCAGATGACGCACGTGGAGTCAAGTCGCTCCCGAGCGCGGGCGTTGCAAG
CGATGATCCCGACAACCAATGA
 Primer design