SecReT4
Protein ID: 116687317
T4SS name [ID]Tra_F [516]
Gene symbol-
Locus tagBcen2424_6944
StrainBurkholderia cenocepacia HI2424
Repliconplasmid 1 [GenBank: NC_008545] [Browse all T4SS(s) in this replicon]
Location [Strand]157460..159568 [+]
ProductType IV secretory pathway VirD4 components-like protein
Component typeTraD_F
UniProt IDA0B526
KEGG IDbch:Bcen2424_6944
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 7e-142, Aligned region: 171..557
TraG-D_C [PF12696], Evalue: 1.5e-19, Aligned region: 416..537
T4SS-DNA_transf [PF02534], Evalue: 1.9e-16, Aligned region: 373..558
AAA_10 [PF12846], Evalue: 1.2e-10, Aligned region: 413..494
TraD_N [PF12615], Evalue: 4.8e-10, Aligned region: 37..129
Protein Sequence: 702 a.a.     [Download]
>gi|116687317|ref|YP_840563.1| Type IV secretory pathway VirD4 components-like protein [Burkholderia cenocepacia HI2424]
MADQRSPSGLATFSRGTALWWQQAKLLTSAIVAVVIAAILVGALAGGAYLYFVTSAETRYLTIKHVEAEI
LTVVPMANPNVSFHLGNDDTALPPAAALSFTEDAADEFFIYARNAALYAVLTAIAVTFLSVLFWMEYGRG
KLTDKQVRGAKLVKAKELIKELEARDDASPYRIAGVPMRKKAEVLGTLFSGAQGSGKSQQFFALMDQVRA
RKKRAIVYDPSGEFTAAYYREGKDVILNPLDARSPNWNAWREIQSEIHYDGLAEGLIPIPPNVADPFFAI
AGRMVFKGAIRALGGDNKRTNAALYKAIAHSNLEELHAILANESAATYVDPVTERTGMSLKMTVQNQLDC
FRYLHDEGEPFSIREWIQNEDEDDDSWLFITVNEEQKTALLPLISLWCDIAIRSLLTLKPIHRERLWYFY
DELPTLQKLEIMKLAVTNIRKYGGCFVLGIQDFSQLFQIYGEHLARTIISGCQTKLLLRVTDGDAAKALA
NAIGQADLDEKEESLNLGIDERRDGMSVFARRNLRDLVLSSEILHLPDMQGYLVTPSDYPVARVKYEYVP
HPQTVTPFIPRQTYDLWLPAGAAADRPAAPERQSTALPSPPSPTARFGSDPSPSHSPSPNPSGAPTTAAE
DSATNAASAGPAVGAPAPNTSGCVARPSNVISLSTGEIVDGDTGEVHSTSAPREPVTGERPTGRAGLGDL
LG
 
Nucleotide Sequence: 2109 bp     [Download]
>gi|116687164|ref|NC_008545.1|:157460-159568 Burkholderia cenocepacia HI2424 plasmid 1, complete sequence
ATGGCTGATCAACGCTCCCCCAGCGGACTCGCCACCTTTTCACGAGGAACTGCCCTCTGGTGGCAACAGG
CAAAGCTTCTCACCAGTGCGATCGTGGCGGTTGTCATCGCGGCAATTCTCGTCGGTGCGCTGGCCGGCGG
TGCATACCTGTATTTCGTCACGTCCGCCGAAACTCGCTATTTGACGATCAAGCACGTGGAGGCGGAAATC
CTCACAGTCGTTCCGATGGCCAATCCGAACGTCTCGTTCCACCTCGGCAACGACGACACGGCACTGCCGC
CCGCTGCGGCGCTGTCGTTTACCGAGGATGCGGCCGACGAGTTCTTCATCTATGCGCGCAATGCTGCCCT
GTACGCTGTTTTAACCGCTATTGCCGTCACGTTCCTTTCCGTCCTGTTTTGGATGGAGTACGGCCGCGGA
AAACTTACCGACAAGCAGGTGCGCGGTGCCAAGCTCGTCAAAGCAAAGGAGCTCATCAAGGAACTGGAGG
CTCGAGACGACGCCAGCCCCTATCGCATCGCCGGCGTGCCGATGCGGAAGAAGGCCGAAGTGCTCGGCAC
ACTCTTTTCTGGTGCCCAAGGCAGTGGCAAGTCCCAGCAGTTTTTTGCGCTGATGGATCAGGTGCGCGCC
CGCAAAAAACGGGCGATCGTCTATGACCCATCAGGCGAATTCACCGCTGCGTATTACCGCGAAGGGAAGG
ACGTCATCCTGAATCCGCTCGACGCGCGTAGCCCGAACTGGAATGCCTGGCGCGAAATCCAAAGCGAGAT
CCATTACGACGGGCTGGCTGAGGGGCTCATCCCGATTCCACCGAATGTCGCCGACCCATTCTTCGCGATT
GCGGGGCGCATGGTTTTCAAGGGAGCGATTCGTGCGCTTGGCGGCGACAACAAACGAACCAACGCAGCGC
TGTACAAGGCCATCGCCCATAGCAATCTCGAGGAATTGCACGCGATCCTAGCGAACGAGTCTGCGGCGAC
CTACGTCGATCCAGTCACTGAGCGTACGGGCATGAGCCTCAAGATGACCGTGCAGAACCAGCTCGATTGC
TTTCGTTACCTGCACGACGAAGGCGAGCCATTTTCGATCCGAGAATGGATCCAGAATGAGGATGAAGACG
ACGATTCCTGGCTGTTCATTACCGTCAACGAGGAGCAGAAAACCGCCCTGCTTCCGCTCATCAGCCTCTG
GTGTGATATCGCTATCCGGTCGCTGCTGACGCTCAAGCCGATTCATCGCGAACGTCTCTGGTACTTCTAC
GACGAGCTCCCCACTCTGCAAAAGCTCGAGATCATGAAGCTCGCCGTTACCAACATTCGGAAGTACGGCG
GTTGCTTCGTACTCGGCATCCAGGACTTTTCCCAACTCTTCCAGATCTACGGCGAGCACTTGGCGCGCAC
GATCATCTCCGGATGCCAGACCAAGCTCCTGTTGCGCGTGACCGATGGTGACGCGGCCAAGGCATTGGCC
AACGCGATCGGTCAGGCCGACCTCGACGAAAAGGAGGAAAGCCTGAATCTCGGCATCGACGAGCGGCGCG
ACGGCATGAGCGTTTTTGCGCGACGCAATCTCCGCGATCTCGTCCTCTCATCAGAAATTCTGCACCTGCC
CGACATGCAGGGCTATCTGGTCACGCCGAGCGACTATCCGGTTGCCCGGGTCAAGTACGAGTACGTCCCC
CATCCCCAAACGGTGACGCCCTTCATCCCGCGCCAAACGTACGATCTCTGGCTTCCGGCAGGCGCTGCAG
CTGACCGTCCGGCTGCGCCGGAGAGACAATCGACTGCGCTACCTTCCCCGCCCAGCCCGACGGCGAGGTT
CGGCAGCGACCCGTCCCCGTCCCACTCCCCGTCACCCAATCCTTCCGGCGCACCGACCACGGCCGCCGAG
GATTCGGCGACCAACGCCGCTTCGGCCGGTCCGGCTGTCGGTGCCCCCGCGCCGAACACTTCTGGCTGCG
TAGCACGACCGTCCAATGTGATCTCGCTGTCGACTGGCGAAATCGTCGACGGTGACACCGGCGAAGTTCA
CAGTACGTCGGCTCCCCGCGAGCCAGTCACCGGCGAACGGCCCACCGGCCGCGCCGGTCTCGGCGACTTG
TTGGGGTGA
 Primer design