SecReT4
Protein ID: 116687318
T4SS name [ID]Tra_F [516]
Gene symbol-
Locus tagBcen2424_6945
StrainBurkholderia cenocepacia HI2424
Repliconplasmid 1 [GenBank: NC_008545] [Browse all T4SS(s) in this replicon]
Location [Strand]159575..162469 [+]
ProductTrwC protein
Component typeTraI_F
UniProt IDA0B527
KEGG IDbch:Bcen2424_6945
PDB IDNA
Domain hit(s) vs Pfam TrwC [PF08751], Evalue: 5.2e-86, Aligned region: 7..294
AAA_30 [PF13604], Evalue: 2.8e-49, Aligned region: 434..610
Protein Sequence: 964 a.a.     [Download]
>gi|116687318|ref|YP_840564.1| TrwC protein [Burkholderia cenocepacia HI2424]
MMSMHNVGSAGQALHYFSKDNYYTTDQGLEHSAWFGKGAATLGLNGQVDRNVFFKLLSGQVGDQQLGRVV
LDENGEPEVVHRPGIDLTFSAPKSVSIAAEVFEDREVRLAHEEAVKEALEYVEAYVARARKTVDGQTLVE
PTGNVVAALFRHNTSRDLDPDTHTHALVMNATQRADGEWRSLTNDELYVQQKVIGAIYTSSLARGLQKRG
YAITAPDENGNFELVGVTREQIEHFSQRSAARDRWLRANGIDPANATAAEKERAVLATRERKVGVDHEAL
SVQWRERAQAVGLDYSVIQQKAREAREAGTDARVVKLSGIEALRFAASHLGEREIVLNQYDLVQTALEHA
VGRTSPNQILDAYKKLVHQGKIVDLPDGNITTEKMLNTERWTVENALAQRDVTPAIAPAELVRSRIEQAI
ATARAERNDPTFDYTPGQRGAIEHALTGRDRIVAVQGLAGVGKTTMVKGTVQVAHEQGWLVRGMAATGQA
AKQLENDSGIQADTVTMFEIHEQRRQDDLKVLREYVPDLSRERELWLVDESSFLAQRQMARLFKMAERAD
AKVILLGDRLQLQAIEAGKPFEILQDEGVATAQMTQIQRQKNPELQQAVAITVGTADLAPDEPLTDLNLA
RNARAFDFLEQAGRVTEHEDPRDLIDLMARQYVDRGPRRNQTIIITPFNEDRVEINNAVRAELQERGELD
VNDSAHTIFRSDGDMTRAKQKEAQYYTKDMTVRFGRDYQKILASRGEYMRVVGTRPDEGIVVLRKSDGSL
MEWEPKKYNRVEVYLSETRNLAARDVIRFTRGDELVKNGHEATVVSVNENQAVLRLADGKEIPWDLDAQR
HWDHAYAVTVHAGQGATREQAMLHIPSHKMERDPEDARRQSDVAMTVRRIFGDRSFYVGLTRAVEDLQIF
TTDAILARAAVSRHQDKSSAIETLREHELGEQANTQPQRQRRQQAAQQMQIEPD
 
Nucleotide Sequence: 2895 bp     [Download]
>gi|116687164|ref|NC_008545.1|:159575-162469 Burkholderia cenocepacia HI2424 plasmid 1, complete sequence
ATGATGAGCATGCATAATGTCGGCAGCGCCGGCCAGGCGCTCCACTATTTTTCGAAAGATAACTACTACA
CCACCGATCAGGGACTCGAGCATTCAGCCTGGTTCGGCAAGGGGGCGGCCACCCTAGGTCTGAACGGGCA
AGTCGATCGCAACGTGTTTTTCAAGTTGCTGTCTGGGCAGGTCGGCGATCAGCAACTCGGTCGCGTCGTC
CTGGACGAGAATGGCGAGCCCGAGGTTGTGCATCGACCCGGCATCGACTTGACCTTTTCGGCGCCGAAGA
GCGTCAGTATTGCCGCAGAAGTTTTCGAAGATCGCGAGGTCCGCCTCGCGCATGAAGAGGCTGTCAAGGA
GGCGCTCGAGTACGTCGAGGCGTATGTGGCCCGGGCGCGCAAAACGGTCGATGGCCAGACGCTAGTGGAG
CCGACCGGCAATGTAGTAGCCGCCCTCTTTCGACACAACACGAGCCGAGATCTCGACCCCGATACGCATA
CTCACGCCCTCGTCATGAACGCGACCCAACGCGCGGATGGCGAATGGCGATCACTCACCAATGACGAATT
GTACGTGCAGCAGAAGGTGATCGGCGCAATCTACACGTCCTCGCTCGCGCGCGGGTTGCAGAAGCGGGGC
TATGCCATCACGGCACCCGACGAGAACGGGAATTTCGAATTGGTCGGCGTCACTCGAGAGCAAATCGAAC
ACTTCAGCCAGCGCTCGGCAGCGCGCGATCGATGGCTGCGGGCCAACGGAATCGATCCTGCAAACGCCAC
GGCCGCCGAGAAGGAGCGTGCCGTGCTCGCGACTCGCGAACGCAAGGTCGGCGTCGACCATGAGGCCTTG
TCGGTTCAATGGCGTGAGCGCGCACAAGCAGTCGGCCTCGACTACAGCGTCATTCAGCAGAAGGCTCGGG
AGGCGCGGGAAGCGGGAACGGATGCACGGGTCGTCAAGTTGTCCGGTATTGAAGCCCTACGGTTCGCTGC
GTCTCACCTCGGTGAGCGCGAAATCGTGCTGAACCAATATGACCTCGTCCAGACCGCGCTCGAGCATGCG
GTCGGCCGAACGTCTCCAAATCAGATTCTCGATGCCTACAAAAAGCTGGTCCATCAAGGCAAGATCGTCG
ACCTTCCGGACGGCAACATTACCACCGAGAAGATGCTCAACACGGAGCGCTGGACAGTCGAGAACGCGCT
CGCGCAGCGAGATGTGACGCCGGCGATCGCGCCTGCCGAATTAGTCCGGTCCAGAATCGAACAGGCCATC
GCCACCGCGCGTGCGGAGCGGAACGATCCCACCTTCGACTACACCCCCGGTCAGCGAGGCGCGATCGAGC
ATGCGCTGACGGGCAGAGACCGGATCGTCGCGGTGCAGGGGCTCGCCGGCGTAGGCAAAACCACGATGGT
CAAGGGAACAGTCCAGGTCGCGCACGAGCAGGGTTGGCTTGTACGAGGGATGGCCGCAACCGGCCAGGCT
GCCAAGCAGCTCGAAAACGACTCCGGTATCCAGGCCGATACGGTTACGATGTTCGAGATTCATGAGCAGC
GGCGCCAGGATGATTTGAAGGTCCTGCGCGAGTATGTGCCGGACCTATCACGAGAGCGCGAGCTCTGGCT
CGTCGACGAGTCATCATTCCTCGCCCAACGGCAAATGGCTCGCCTATTTAAGATGGCGGAACGAGCGGAT
GCGAAGGTCATCCTCCTTGGCGACCGCCTCCAGCTGCAGGCCATCGAGGCGGGCAAACCGTTTGAGATCC
TGCAGGACGAGGGCGTGGCCACCGCTCAGATGACCCAGATCCAGCGCCAGAAGAATCCCGAGCTGCAGCA
GGCAGTCGCGATCACCGTGGGCACCGCCGACCTTGCACCGGATGAGCCCCTCACCGACCTGAACCTCGCA
CGTAACGCTCGCGCCTTCGACTTTCTCGAGCAAGCTGGGCGCGTGACGGAACACGAGGATCCGCGAGACC
TGATCGACCTGATGGCGCGCCAGTACGTCGACCGGGGACCACGAAGAAATCAGACGATCATCATCACCCC
GTTTAACGAGGACCGCGTCGAAATCAACAATGCGGTTCGGGCGGAGCTGCAGGAGCGTGGCGAGCTCGAT
GTCAACGACTCGGCACACACCATCTTCCGGTCCGATGGAGATATGACCCGGGCCAAGCAGAAGGAGGCGC
AGTACTACACTAAGGATATGACCGTCCGGTTCGGTCGAGACTATCAGAAAATACTCGCCTCCCGCGGCGA
ATACATGCGCGTTGTGGGTACGCGACCCGACGAGGGTATCGTCGTTCTGCGGAAGTCCGACGGGTCTCTC
ATGGAATGGGAACCGAAGAAGTACAACCGGGTAGAGGTGTATCTCTCGGAAACGAGGAATCTCGCCGCGC
GTGACGTCATTCGCTTCACCCGCGGCGACGAGCTCGTCAAGAATGGTCACGAGGCGACCGTCGTTTCTGT
CAACGAGAACCAGGCGGTCCTGCGGCTCGCGGATGGCAAGGAAATTCCTTGGGATCTCGACGCGCAGCGT
CATTGGGATCACGCGTATGCGGTGACGGTTCACGCAGGCCAAGGCGCGACCCGCGAGCAAGCCATGCTGC
ATATCCCGTCACACAAAATGGAGCGTGATCCGGAAGATGCTCGGCGCCAGTCAGACGTCGCGATGACGGT
GCGTAGGATCTTCGGTGACCGGAGCTTCTATGTCGGGCTCACCCGGGCGGTCGAGGATCTCCAGATTTTC
ACGACCGACGCAATTCTCGCTCGAGCGGCCGTCTCACGCCACCAGGACAAGTCAAGCGCCATCGAGACGC
TGCGTGAGCATGAGTTGGGCGAGCAGGCGAATACCCAGCCGCAGCGCCAGCGACGTCAACAAGCTGCGCA
ACAGATGCAGATCGAGCCGGACTGA
 Primer design