SecReT4
Protein ID: 116691419
T4SS name [ID]VirB [217]
Gene symbol-
Locus tagBcen2424_3318
StrainBurkholderia cenocepacia HI2424
Repliconchromosome 2 [GenBank: NC_008543] [Browse all T4SS(s) in this replicon]
Location [Strand]154023..154727 [+]
ProductVirB8 family protein
Component typeVirB8
UniProt IDA0AXD3
KEGG IDbch:Bcen2424_3318
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.1e-48, Aligned region: 10..220
Protein Sequence: 234 a.a.     [Download]
>gi|116691419|ref|YP_836952.1| unnamed protein product [Burkholderia cenocepacia HI2424]
MNDQSDYRRALDFEASLTALQACSERRAWQVAFAAVIVAIGSVAALAVMMPFYRVVPLPIEVNKLTGEAQ
FIEVLDAKHVPLREIEDKHWVEVYVRTRERYDWGLLQMDYDRVLDMSDESVARAYRQIYSGPNALDQQLG
ASVQYRTRIVSTTLVPDEPGHAVVHLERTVRKNGIDTGEPAKRFVITLAFTYRPTVLVRERSAIENPFGF
KVTAYSRDAEDTPPAPQPGAGAGR
 
Nucleotide Sequence: 705 bp     [Download]
>gi|116691273|ref|NC_008543.1|:154023-154727 Burkholderia cenocepacia HI2424 chromosome 2, complete sequence
GTGAACGATCAAAGCGATTATCGGCGTGCGCTTGATTTTGAGGCGTCGCTCACCGCATTGCAGGCATGCT
CCGAACGTCGCGCATGGCAAGTGGCGTTTGCCGCCGTTATTGTTGCGATCGGTTCGGTAGCGGCGCTTGC
CGTGATGATGCCGTTTTATCGCGTGGTGCCGTTGCCTATCGAGGTGAACAAGCTCACCGGCGAGGCGCAA
TTCATCGAGGTGCTCGACGCAAAACACGTGCCGCTGCGTGAGATCGAAGATAAGCACTGGGTCGAAGTCT
ATGTACGCACTCGCGAGCGCTACGACTGGGGACTGTTGCAAATGGATTATGACCGTGTCCTGGATATGAG
CGACGAATCGGTCGCGCGCGCATATCGTCAAATCTATAGCGGTCCGAACGCGTTGGATCAGCAACTGGGC
GCGTCAGTTCAATACCGCACCCGAATAGTGTCGACGACGCTCGTGCCCGACGAGCCGGGACATGCTGTCG
TGCATCTCGAGCGAACGGTGCGCAAGAACGGCATCGATACCGGTGAGCCAGCAAAGCGCTTTGTGATTAC
GCTCGCCTTTACCTACCGCCCCACGGTGCTGGTGCGGGAACGTTCGGCCATCGAAAATCCATTCGGCTTC
AAGGTGACGGCGTACAGCCGAGATGCGGAGGATACGCCACCTGCTCCACAGCCCGGTGCAGGAGCTGGCC
GATGA
 Primer design