SecReT4
Protein ID: 116691422
T4SS name [ID]VirB [217]
Gene symbol-
Locus tagBcen2424_3321
StrainBurkholderia cenocepacia HI2424
Repliconchromosome 2 [GenBank: NC_008543] [Browse all T4SS(s) in this replicon]
Location [Strand]156854..157912 [+]
ProductATP/GTP-binding motif-containing protein
Component typeVirB11
UniProt IDA0AXD6
KEGG IDbch:Bcen2424_3321
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1e-60, Aligned region: 5..309
MobB [PF03205], Evalue: 3.6e-05, Aligned region: 161..190
Protein Sequence: 352 a.a.     [Download]
>gi|116691422|ref|YP_836955.1| unnamed protein product [Burkholderia cenocepacia HI2424]
MRSFAPLLADEAVTELVINRPQRILTETHRGWQAHDLPELDFERLMAFAVAIATLTNQGVSTEHPLLSAL
LPDNARLQLVVPPVVPPRTVSITIRRPSADEKTLECHRADGMFEDTVWRHVDGLGKTGLALRGADRMLVE
RLEARDFSAFFESAVRARRNIVIVGSTGSGKTSFMRSLCRYLSATERIVTIEDVRELFIRHLENCVHLLY
SKGAQGRAHITPADLIACAMRMRPDRVLLAELRGAEAYDFLKLLTTGHAGSMTSFHASSAGIAIERFALM
AKEHPEAAAWDIASLKRVLRLTIDVIAHMEAQPVLDSHGVQVGKRWAMTEVWFDPREKAAIEFDPTERCC
DA
 
Nucleotide Sequence: 1059 bp     [Download]
>gi|116691273|ref|NC_008543.1|:156854-157912 Burkholderia cenocepacia HI2424 chromosome 2, complete sequence
ATGCGTTCGTTCGCACCGTTGCTCGCCGACGAAGCGGTAACGGAGCTCGTAATCAACCGACCGCAGCGTA
TTCTGACAGAGACCCATCGGGGGTGGCAGGCACACGATTTACCGGAGCTTGATTTCGAACGACTCATGGC
GTTCGCCGTGGCGATTGCCACATTGACGAATCAGGGCGTCTCGACCGAGCATCCGCTGCTTTCCGCGCTA
TTACCGGATAACGCGCGCCTCCAACTCGTGGTGCCGCCCGTGGTTCCGCCGCGGACGGTATCGATCACGA
TCAGGCGCCCGAGCGCGGATGAAAAGACGCTTGAGTGCCATCGTGCCGATGGCATGTTTGAGGACACGGT
TTGGCGACACGTTGACGGTCTCGGCAAGACAGGCCTAGCGTTGCGCGGAGCCGATCGGATGCTCGTCGAG
CGGCTCGAAGCGCGTGATTTTTCCGCCTTCTTTGAAAGCGCCGTGCGAGCACGCCGCAATATTGTCATTG
TCGGCAGCACGGGCTCCGGCAAGACGAGCTTTATGCGCAGCTTGTGCCGATACCTGAGCGCAACCGAGCG
CATCGTGACGATCGAAGACGTACGCGAGCTGTTCATTCGGCATCTCGAAAACTGCGTCCATCTCCTCTAT
AGCAAAGGCGCTCAGGGGCGCGCACACATAACGCCTGCAGATTTGATTGCCTGCGCCATGCGCATGCGTC
CCGACCGGGTGTTGCTTGCCGAGCTCCGCGGGGCGGAAGCGTACGACTTCCTGAAGCTTTTGACCACCGG
GCACGCCGGCTCGATGACGAGTTTTCATGCGTCCAGTGCGGGCATTGCCATCGAGCGTTTTGCGCTCATG
GCGAAGGAGCATCCCGAGGCAGCCGCCTGGGACATTGCTTCGCTCAAGCGTGTGCTGCGCTTGACCATCG
ACGTGATCGCTCACATGGAGGCGCAGCCCGTATTGGACTCACACGGTGTGCAGGTCGGCAAACGCTGGGC
GATGACCGAAGTCTGGTTCGACCCGCGCGAGAAGGCTGCCATCGAGTTTGACCCAACCGAGAGGTGCTGC
GATGCATGA
 Primer design