SecReT4
Protein ID: 116872190
T4SS name [ID]Ydd [623]
Gene symbol-
Locus taglwe0770
StrainListeria welshimeri serovar 6b str. SLCC5334
Repliconchromosome [GenBank: NC_008555] [Browse all T4SS(s) in this replicon]
Location [Strand]798509..799924 [+]
ProductDNA translocase FtsK
Component typeYdcQ
UniProt IDA0AGQ6
KEGG IDlwe:lwe0770
PDB IDNA
Domain hit(s) vs Pfam FtsK_SpoIIIE [PF01580], Evalue: 3e-28, Aligned region: 187..364
Protein Sequence: 471 a.a.     [Download]
>gi|116872190|ref|YP_848971.1| DNA translocase FtsK [Listeria welshimeri serovar 6b str. SLCC5334]
MKFINYRGTRIRPYHLNVYRHYLFGMWSPALLVSGAYGYFVLYPLVSEIFEKQSIDYAALLLPVGGLFLW
LLLPLFICLWGRRQSFLKGGFFYRAYQRQMLARMLKSNGLYDKKERKSNERIAEKMIFPKVYYRNTKEIL
YLTVPTDGMKWHDRFEKIAKTFEEMYIADFINVQKEMGYTTYSLMIDVISKRIDISDCVVTNGQVKLMEG
VVWDYAEVPHMLITGGTGGGKTYLILTLIQALVKVGTVDICDPKEADLKDLQDLKLFKGHVFTGTKWITR
CLKNAVAEMNRRYVYMKLLPNYTTGKNFAYYDIPPYFIIVDEWAAFFGTLNYKEQDEISGYVKELVLKAR
QAGVFLILATQRPDAENFGGGIRDNILFRVSVGKLQEQGYYMTFGSDQKNKAFINKSIKGRGYVDDGSAV
PREFYAPFVPKGYNFLKEFEKIESMKLLDIREVDPTAEEIEVAQKAFEVIR
 
Nucleotide Sequence: 1416 bp     [Download]
>gi|116871422|ref|NC_008555.1|:798509-799924 Listeria welshimeri serovar 6b str. SLCC5334 chromosome, complete genome
ATGAAATTTATAAACTACAGGGGCACCAGAATCCGTCCGTATCACTTGAATGTCTATCGTCATTACTTGT
TTGGTATGTGGTCTCCAGCACTCCTTGTTAGCGGTGCCTATGGCTATTTTGTACTATATCCATTAGTAAG
TGAAATTTTTGAAAAACAATCAATAGATTATGCTGCTCTCCTTCTTCCAGTTGGAGGGCTTTTTTTATGG
CTCTTACTTCCGTTGTTCATTTGTTTATGGGGGAGAAGACAGTCTTTTCTAAAAGGTGGTTTCTTTTATC
GAGCCTATCAACGGCAAATGTTGGCACGAATGTTAAAAAGCAATGGCTTGTACGATAAGAAAGAACGAAA
ATCAAACGAGCGAATCGCAGAAAAGATGATTTTCCCTAAAGTTTATTATCGGAATACCAAGGAAATTCTT
TATTTAACGGTTCCAACAGATGGAATGAAGTGGCATGATCGTTTTGAAAAAATTGCGAAAACTTTTGAAG
AAATGTATATTGCCGATTTTATCAATGTGCAGAAAGAGATGGGTTATACAACCTATTCCTTGATGATTGA
TGTGATTAGTAAACGGATTGATATTTCAGATTGTGTTGTCACAAATGGTCAAGTCAAATTGATGGAAGGT
GTGGTTTGGGATTATGCAGAAGTGCCACATATGTTAATTACAGGCGGCACAGGTGGAGGCAAGACCTATC
TAATTTTGACGTTAATTCAAGCATTGGTAAAAGTGGGAACCGTTGATATTTGTGATCCAAAAGAAGCGGA
TTTAAAGGATTTACAAGACCTTAAATTATTCAAGGGACATGTCTTTACTGGAACAAAATGGATTACTCGT
TGTTTGAAAAATGCCGTAGCAGAAATGAATCGCCGCTACGTCTATATGAAGCTTCTCCCAAACTATACAA
CAGGGAAAAACTTTGCTTATTACGATATTCCGCCTTATTTCATCATTGTAGATGAATGGGCCGCATTTTT
CGGAACCTTAAACTATAAAGAACAGGATGAAATTTCAGGGTATGTAAAAGAATTAGTGTTAAAGGCTCGT
CAAGCAGGTGTTTTCTTAATTCTTGCGACACAACGCCCTGATGCAGAGAACTTTGGTGGAGGGATTCGTG
ATAATATCTTGTTTCGGGTGAGTGTTGGAAAGCTTCAAGAACAGGGCTATTATATGACTTTTGGATCAGA
TCAAAAGAATAAGGCGTTTATCAATAAGTCAATTAAAGGAAGAGGGTATGTGGATGATGGCTCAGCTGTA
CCAAGAGAATTCTATGCTCCATTTGTTCCTAAGGGCTATAACTTTTTAAAAGAATTTGAAAAGATTGAAT
CGATGAAACTATTAGATATCAGGGAGGTTGATCCAACTGCTGAGGAAATTGAAGTGGCACAAAAAGCATT
TGAAGTAATTCGATAA
 Primer design