SecReT4
Protein ID: 116872196
T4SS name [ID]Ydd [623]
Gene symbol-
Locus taglwe0776
StrainListeria welshimeri serovar 6b str. SLCC5334
Repliconchromosome [GenBank: NC_008555] [Browse all T4SS(s) in this replicon]
Location [Strand]806005..807024 [+]
Producthypothetical protein
Component typeYddB
UniProt IDA0AGR2
KEGG IDlwe:lwe0776
PDB IDNA
Domain hit(s) vs Pfam TpcC [PF12642], Evalue: 3.3e-38, Aligned region: 85..331
Protein Sequence: 339 a.a.     [Download]
>gi|116872196|ref|YP_848977.1| hypothetical protein lwe0776 [Listeria welshimeri serovar 6b str. SLCC5334]
MNFIKERKQPKPVVPKEEKAASIRTVRLSVLILTLFLVVSGPIALFQSSKMQGRIKNEQAALSQTIQEEL
LKNTSTPVASELYKQFLHPFITTYISIPADQKAFEERLNTLQDTYFNFEQEEEKNTGLERKLLSTDFYDL
VSEQGQTIAKYKIAYEIITPITKEREVKKKEGDKEVTIKEKYIDYEKSEVKMLLNIPFVQLDNQSFKVTA
YPYFSMEPALTSGKALQSTIDRSQYQRLENKEEKAITSFVQAFLEKYVSDSIEDMSFLMKEPELLTGDYQ
VTDVAIEPLIKEKQIVVFVTFKLVDGQTKSSHIETMTLGLKHRDNTYFIEKLQHYLGGI
 
Nucleotide Sequence: 1020 bp     [Download]
>gi|116871422|ref|NC_008555.1|:806005-807024 Listeria welshimeri serovar 6b str. SLCC5334 chromosome, complete genome
ATGAACTTTATAAAAGAGAGAAAACAACCAAAGCCAGTTGTTCCAAAAGAAGAAAAAGCAGCGAGTATCC
GAACCGTTCGTCTAAGTGTTCTGATCCTGACACTTTTTTTAGTGGTAAGTGGTCCAATTGCGTTGTTTCA
GTCTTCCAAGATGCAAGGAAGGATAAAAAATGAACAAGCAGCATTATCACAAACCATTCAAGAAGAACTG
TTGAAAAATACGAGTACGCCTGTTGCATCTGAATTATACAAGCAGTTCTTACATCCATTTATCACTACCT
ATATCTCAATTCCAGCTGATCAAAAAGCATTTGAAGAAAGACTTAATACGTTGCAGGATACCTATTTTAA
CTTTGAGCAGGAAGAAGAGAAAAATACAGGGCTTGAGAGAAAATTACTTTCTACTGATTTTTATGATTTG
GTAAGTGAGCAGGGACAAACGATCGCAAAATATAAGATTGCTTATGAAATTATAACACCTATCACAAAAG
AACGAGAAGTGAAGAAAAAAGAAGGAGACAAAGAAGTAACAATCAAAGAAAAATACATCGATTATGAGAA
AAGTGAAGTAAAAATGTTACTCAATATTCCTTTTGTTCAATTAGACAATCAATCGTTTAAAGTTACTGCG
TATCCTTATTTTTCAATGGAGCCTGCTTTAACATCTGGAAAGGCACTTCAATCAACAATTGATCGATCTC
AGTACCAACGACTAGAGAATAAAGAAGAAAAAGCAATTACCAGTTTTGTGCAAGCTTTTCTTGAAAAATA
TGTTTCAGATTCGATAGAAGACATGAGCTTTTTGATGAAAGAGCCAGAGTTATTGACTGGTGATTATCAA
GTTACAGATGTAGCGATTGAACCTTTAATAAAAGAGAAACAGATTGTCGTCTTTGTTACGTTCAAACTAG
TGGATGGACAGACCAAAAGTAGTCATATAGAAACGATGACATTAGGACTGAAACACCGAGACAACACGTA
TTTTATTGAAAAATTACAGCACTATCTAGGAGGAATTTAA
 Primer design