SecReT4
Protein ID: 116872198
T4SS name [ID]Ydd [623]
Gene symbol-
Locus taglwe0778
StrainListeria welshimeri serovar 6b str. SLCC5334
Repliconchromosome [GenBank: NC_008555] [Browse all T4SS(s) in this replicon]
Location [Strand]807351..808037 [+]
Producthypothetical protein
Component typeYddD
UniProt IDA0AGR4
KEGG IDlwe:lwe0778
PDB IDNA
Domain hit(s) vs Pfam TcpE [PF12648], Evalue: 3.8e-23, Aligned region: 9..110
Protein Sequence: 228 a.a.     [Download]
>gi|116872198|ref|YP_848979.1| hypothetical protein lwe0778 [Listeria welshimeri serovar 6b str. SLCC5334]
MNREKQILDYREPFNAPYMIREIAKNVNLPFVVYAQDFTIATVSFALVFSCLLFLFGMNQLVIMISIAIP
YGLIQLFNRVEPDGKRADIFLKDYLSYLVTYVMKHQVLYHEQLQTMKQEKVIYDCCTVTLLMIKEEEIPM
NTITVDQVKKEIKELIVPELIHEFEPIKAREEGFYGLFETDDEVLLMKKTLHRQYTDGLLPLTEVLKLKD
QYQPLIKQSLRKRITRLL
 
Nucleotide Sequence: 687 bp     [Download]
>gi|116871422|ref|NC_008555.1|:807351-808037 Listeria welshimeri serovar 6b str. SLCC5334 chromosome, complete genome
ATGAACAGAGAAAAACAGATTTTAGATTATCGTGAGCCGTTTAATGCACCCTATATGATTCGAGAAATTG
CGAAAAATGTCAATTTACCGTTTGTGGTCTATGCACAAGATTTTACTATCGCTACGGTGAGCTTTGCGCT
GGTTTTCAGCTGCTTATTGTTTTTGTTTGGAATGAACCAATTAGTGATTATGATCTCTATTGCGATACCT
TACGGATTGATTCAATTGTTTAATCGTGTGGAACCCGATGGAAAGCGAGCCGATATTTTCTTAAAAGATT
ACCTGAGCTACTTGGTGACGTATGTCATGAAGCATCAGGTGTTATACCATGAGCAGCTTCAAACAATGAA
ACAAGAAAAAGTGATTTATGACTGCTGCACAGTGACGCTACTAATGATAAAGGAGGAAGAGATACCAATG
AATACCATAACTGTAGATCAAGTGAAAAAAGAAATAAAAGAACTCATTGTTCCAGAACTCATCCATGAAT
TTGAGCCCATAAAGGCAAGAGAAGAAGGGTTCTATGGATTATTTGAAACAGATGATGAGGTATTACTTAT
GAAAAAGACCCTTCATCGCCAGTATACAGATGGATTGCTTCCACTGACGGAGGTGCTCAAGTTGAAAGAC
CAATACCAACCATTAATCAAGCAATCCTTACGCAAACGGATCACTCGATTATTATAA
 Primer design