SecReT4
Protein ID: 116872199
T4SS name [ID]Ydd [623]
Gene symbol-
Locus taglwe0779
StrainListeria welshimeri serovar 6b str. SLCC5334
Repliconchromosome [GenBank: NC_008555] [Browse all T4SS(s) in this replicon]
Location [Strand]808051..810573 [+]
ProductATPase
Component typeYddE
UniProt IDA0AGR5
KEGG IDlwe:lwe0779
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.8e-24, Aligned region: 466..781
DUF87 [PF01935], Evalue: 5.3e-06, Aligned region: 463..647
Protein Sequence: 840 a.a.     [Download]
>gi|116872199|ref|YP_848980.1| ATPase [Listeria welshimeri serovar 6b str. SLCC5334]
MRLKQPFHKVYRNVLITTENEVWAYFTCPSEYVIGQNKEVQEKHKRKWNQFLQSLRRFEDFELFLNPHSY
NLNERLSAFSKSFDEEAQDMGDALINRTLSELESQLRVITTEKFYIGVKLSSLSSATSLKGKAMELVDYY
AGKLLAITQYHMTVDEDFLARYRIIEAEVFQLVGAINGRRLTEKEVLQVCRYPYVRGMATSFDSDFIEKE
GYSLTDTILDPTEEQGLLKLRSLEGTNYIALLPIHKFAPNLAFNHVAELVQSLPFPVEFRLKAHFEPLKG
GKGLKGKSSRASKRLKNSAKETLSMGDAEMKSSRFNRYALTDLNNKIDLRVPVIKWLGLFGVFGQTPEEC
RSRIRTVLSLCQSRNVDVVKGLADQVFLFHQFLSGNKLGPEKNWIHYTTVEGISELMLGVENRIGDNVGI
PIGMVSELKNTRNLTPKEIAKTSRKPVFFNPSIGNQSDIADKKANSPHIAITGPTGNGKSYLAKFVFFLS
VLMKGKGLYVDPKSEFFDWIMEVINDPVYQKKYPETCTFVQQHFHQVRLDPDKKSNKGVLDPICFIPNRV
AAKDMAQDLFEELYNFTSAREKKSRLAMLEGIEVVLKKRDYGERVGLLHVVDYMLENDNEEVRDTANLIK
KSVQGSILELAFSYGENEGLNLHNKVTVLEVLGLEMPRAETLSNDYSATQRKSIMLMMCIGKFCELFGLR
DREESTVVLFDESWIFNTSKNGRAIIKSMRRVGRSFNNTLIIVTQSVKDTAEEDDTGNFGRIFAYDDKDE
REEILRHLGLEVSEENIEWLKNLPKYHCLYLDLRGRVGKMLVYCPYEELHQMLQTVKKNASADVETAFSA
 
Nucleotide Sequence: 2523 bp     [Download]
>gi|116871422|ref|NC_008555.1|:808051-810573 Listeria welshimeri serovar 6b str. SLCC5334 chromosome, complete genome
ATGAGATTAAAACAACCCTTTCATAAAGTGTATCGCAATGTGCTGATTACGACAGAAAATGAGGTGTGGG
CATATTTTACGTGTCCAAGCGAGTATGTCATTGGTCAGAACAAAGAAGTACAAGAAAAACATAAACGAAA
ATGGAATCAGTTTCTTCAAAGTTTACGGCGTTTTGAAGATTTTGAATTATTTCTTAATCCTCATTCGTAT
AATCTCAATGAACGATTATCTGCATTTTCTAAAAGTTTTGATGAAGAAGCCCAAGATATGGGCGATGCCT
TGATTAATCGTACCTTGTCTGAATTAGAAAGTCAGCTACGAGTGATTACAACAGAGAAATTTTACATTGG
TGTGAAGCTGTCTAGTCTGTCTTCTGCGACTTCTCTTAAAGGAAAAGCAATGGAATTGGTAGATTATTAT
GCAGGTAAACTCTTAGCGATTACGCAGTACCACATGACCGTTGACGAGGATTTTTTGGCACGTTATCGCA
TCATTGAAGCAGAAGTTTTTCAATTAGTCGGGGCGATCAATGGTCGAAGATTAACTGAAAAAGAAGTGTT
ACAAGTCTGTCGTTATCCCTATGTTCGTGGGATGGCAACCTCTTTCGATAGTGATTTTATTGAAAAAGAA
GGATACTCCCTAACGGATACGATTCTTGATCCTACAGAGGAACAAGGCTTGTTAAAACTACGAAGTTTAG
AAGGAACCAATTATATTGCGCTATTGCCAATTCATAAATTTGCGCCGAATTTGGCCTTTAATCATGTGGC
AGAGCTAGTTCAAAGCCTGCCTTTTCCAGTAGAGTTTCGGTTGAAGGCACATTTTGAGCCCTTGAAAGGA
GGTAAAGGATTAAAAGGAAAATCTTCTAGAGCATCCAAGCGCTTAAAGAATAGTGCCAAAGAAACCCTAT
CCATGGGTGATGCTGAAATGAAATCCAGTCGGTTTAATCGGTATGCCTTGACAGATTTAAATAATAAAAT
TGATTTACGAGTTCCAGTCATTAAATGGTTGGGGCTTTTTGGTGTCTTTGGACAAACGCCAGAAGAGTGT
CGTAGCCGAATTCGTACAGTACTCTCTTTGTGTCAGTCTCGTAATGTGGATGTTGTCAAAGGATTAGCAG
ATCAAGTTTTTCTATTTCACCAATTCTTGTCTGGAAATAAATTAGGACCCGAAAAGAATTGGATTCATTA
CACCACTGTAGAAGGTATCAGCGAATTGATGCTAGGGGTAGAAAATAGAATTGGAGATAATGTAGGTATT
CCCATTGGTATGGTATCAGAATTAAAAAATACACGGAATTTAACGCCTAAAGAAATTGCGAAAACCAGTC
GTAAGCCAGTATTTTTTAATCCGTCTATTGGGAATCAAAGTGATATCGCTGATAAGAAAGCAAATAGTCC
GCACATTGCCATTACAGGACCTACAGGAAATGGAAAGTCCTATTTGGCTAAATTTGTGTTCTTTCTCTCT
GTACTGATGAAAGGAAAAGGGCTCTATGTTGACCCAAAATCCGAATTCTTTGATTGGATCATGGAAGTGA
TCAATGACCCAGTGTATCAGAAAAAGTATCCTGAAACGTGTACCTTTGTTCAGCAGCACTTTCACCAAGT
TAGACTTGATCCAGACAAAAAGAGTAATAAAGGCGTTCTTGATCCTATTTGTTTTATTCCAAACCGAGTT
GCGGCAAAAGATATGGCACAAGATTTATTTGAAGAATTGTATAACTTTACGAGTGCGAGAGAGAAGAAAT
CTCGTCTAGCCATGTTAGAAGGTATCGAAGTAGTCTTGAAGAAACGAGATTATGGAGAACGAGTTGGTCT
TCTTCATGTGGTTGATTACATGTTAGAAAATGATAATGAGGAAGTCCGAGATACTGCTAATTTGATCAAA
AAATCTGTTCAAGGGTCTATTTTAGAATTGGCATTTAGTTATGGCGAAAATGAGGGATTGAACCTGCATA
ACAAAGTGACTGTACTTGAAGTGTTAGGGCTAGAAATGCCTAGAGCAGAAACCTTAAGTAATGATTATAG
TGCCACCCAAAGAAAATCCATTATGTTAATGATGTGTATTGGAAAGTTCTGTGAGTTGTTTGGTTTGCGA
GATCGAGAAGAAAGCACCGTGGTACTTTTTGACGAGAGCTGGATTTTTAACACGTCAAAAAATGGGCGAG
CGATTATTAAATCCATGCGCCGAGTTGGTCGAAGTTTTAACAATACCTTAATTATTGTGACACAATCTGT
AAAAGACACCGCAGAAGAAGATGACACAGGGAATTTTGGACGTATTTTTGCCTATGATGATAAGGATGAA
CGAGAAGAGATTCTTCGTCATTTAGGCTTAGAAGTGAGTGAGGAAAACATTGAGTGGTTAAAAAATTTAC
CTAAGTACCATTGTCTTTATTTAGATTTAAGAGGGCGTGTTGGAAAAATGTTAGTCTATTGTCCTTATGA
AGAATTGCATCAAATGTTGCAAACCGTGAAGAAAAATGCAAGTGCAGACGTGGAAACTGCCTTTAGTGCA
TAG
 Primer design