SecReT4
Protein ID: 116872200
T4SS name [ID]Ydd [623]
Gene symbol-
Locus taglwe0780
StrainListeria welshimeri serovar 6b str. SLCC5334
Repliconchromosome [GenBank: NC_008555] [Browse all T4SS(s) in this replicon]
Location [Strand]810589..812367 [+]
Producthypothetical protein
Component typeYddG
UniProt IDA0AGR6
KEGG IDlwe:lwe0780
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 592 a.a.     [Download]
>gi|116872200|ref|YP_848981.1| hypothetical protein lwe0780 [Listeria welshimeri serovar 6b str. SLCC5334]
MLKDVFDIDSFQSFFEKGGWFSINENLQSVLNALINLAFGLIKYMVLALDYVIEQLFNLNLLDGILPDLF
STAGSIYNQLFNVLGILLFTFVIVISVKDFFEKGISKALIRFGIFTLIYAGSMAFFSDGAAKVQEVNTIS
QNVQGQLVDLTSSSLNSSNQSTTEKLIGSEQQLDGTSNIRNLIFDEFIIKPYALLNFGKTDITKEQFELY
LVKNGETFDKEKTKEIEKKIKQDSEKNSYLTSDRMTEKVAVLLNTFVMLFVIGIAVLLIGVANILIQLLI
YGIIFLFPSLLFLALIPNMHHLIKNGFMMLGTLFASKVGIGFCFGLLFSIINLLDSFFVVTNIVTMLVGL
FVKVLLGLFIWKNKGQIVRSLTKGKTELRDFKFPKRAANNRQQEIEQREDQQNRLAEQTYKTQTAENDYL
RSGVELDRAYRQNDFQDNLLVQAGNEANSPESTSFDAGDTESVNPEVESIKSKDSNSSDEKEERLSDSEP
DIEPVVGTSTVDQETSLPLEEMDDGLIYQQPSYEEFEQRQIDQIEENEANRTESPRVTHESQDQPVPVEL
VEAKQLAKEMGELRKEIYEEVEISEESAYEDL
 
Nucleotide Sequence: 1779 bp     [Download]
>gi|116871422|ref|NC_008555.1|:810589-812367 Listeria welshimeri serovar 6b str. SLCC5334 chromosome, complete genome
TTGTTAAAAGATGTCTTCGATATTGATTCTTTCCAGTCTTTCTTTGAAAAGGGTGGTTGGTTTAGTATCA
ATGAGAATTTACAAAGTGTTCTAAACGCCTTAATTAACCTTGCTTTTGGACTGATTAAGTACATGGTTCT
TGCGCTTGATTATGTCATTGAACAATTGTTTAATTTAAATCTTTTGGATGGGATATTGCCTGATTTATTT
TCTACAGCTGGTTCTATCTATAACCAATTATTTAACGTATTGGGTATCTTACTTTTCACCTTTGTCATTG
TCATTTCTGTCAAAGACTTCTTTGAAAAAGGTATTAGTAAAGCTCTAATTCGATTTGGTATTTTTACATT
GATTTATGCAGGCAGTATGGCATTCTTTTCAGACGGAGCAGCCAAAGTGCAAGAGGTCAATACGATTTCT
CAGAACGTTCAAGGGCAACTAGTCGATTTAACGAGCAGTAGCTTAAATAGTAGCAATCAATCTACAACGG
AAAAGTTGATTGGTAGTGAGCAGCAGCTAGATGGCACGAGTAATATTCGTAATCTGATTTTTGATGAATT
TATTATTAAACCTTATGCACTACTTAATTTCGGAAAAACAGACATTACAAAAGAACAATTTGAGCTGTAT
TTAGTTAAGAACGGAGAAACCTTTGATAAAGAAAAGACGAAAGAAATTGAGAAAAAAATTAAGCAAGACT
CTGAAAAAAATTCTTATCTGACTTCAGATCGCATGACGGAAAAAGTCGCTGTATTATTGAATACCTTTGT
GATGTTATTTGTGATAGGAATTGCGGTGTTACTAATAGGTGTCGCCAATATTTTGATTCAACTATTGATT
TACGGAATCATTTTTCTCTTTCCATCCCTGCTCTTTTTGGCACTGATTCCCAATATGCATCATTTGATAA
AAAATGGCTTTATGATGCTAGGGACATTGTTTGCCTCTAAGGTGGGAATAGGGTTTTGTTTTGGCTTACT
TTTTTCTATTATTAATCTTTTGGATTCTTTCTTTGTCGTCACCAATATTGTTACCATGTTAGTGGGACTA
TTTGTCAAAGTGTTATTAGGGCTATTTATTTGGAAGAATAAAGGTCAGATTGTTCGTTCATTAACGAAAG
GGAAAACAGAACTGCGAGATTTTAAGTTCCCTAAAAGAGCTGCCAATAATCGGCAACAAGAGATAGAACA
ACGAGAAGATCAACAGAACCGATTGGCTGAGCAAACATATAAGACACAAACCGCAGAAAATGATTATCTT
CGTTCAGGCGTAGAGTTGGATCGTGCTTACCGACAGAATGATTTCCAAGATAACTTATTGGTTCAAGCTG
GAAATGAAGCCAATTCTCCTGAATCAACTTCATTCGATGCAGGCGATACAGAATCAGTAAATCCTGAGGT
TGAGTCAATCAAGAGTAAAGATTCAAATAGCTCTGACGAAAAAGAAGAAAGATTATCTGATAGTGAGCCT
GATATAGAACCAGTGGTGGGAACATCAACAGTGGATCAAGAAACGTCTTTACCATTGGAAGAAATGGATG
ATGGACTTATTTACCAACAACCTAGTTATGAGGAATTTGAGCAACGTCAGATAGACCAAATTGAAGAAAA
TGAGGCTAATCGAACTGAATCACCTCGTGTTACTCATGAATCGCAGGATCAACCAGTACCTGTAGAACTA
GTAGAAGCTAAGCAATTAGCAAAAGAAATGGGAGAGCTTAGAAAAGAAATCTACGAGGAAGTAGAAATCA
GTGAGGAGTCAGCCTATGAAGATCTCTAA
 Primer design