SecReT4
Protein ID: 116872201
T4SS name [ID]Ydd [623]
Gene symbol-
Locus taglwe0781
StrainListeria welshimeri serovar 6b str. SLCC5334
Repliconchromosome [GenBank: NC_008555] [Browse all T4SS(s) in this replicon]
Location [Strand]812354..813382 [+]
Productcell wall protein
Component typeYddH
UniProt IDA0AGR7
KEGG IDlwe:lwe0781
PDB IDNA
Domain hit(s) vs Pfam Lysozyme_like [PF13702], Evalue: 3.7e-47, Aligned region: 41..195
CHAP [PF05257], Evalue: 8.9e-08, Aligned region: 241..331
Protein Sequence: 342 a.a.     [Download]
>gi|116872201|ref|YP_848982.1| cell wall protein [Listeria welshimeri serovar 6b str. SLCC5334]
MKISKRLAFFLVSFFFIFILLIGGTSSSTSVTDTEEGQNLPEAVLRWKEKVTKEAVKNEISEAVPYLLGI
IMVETGGNSEKYPDIMQCSESQGRQPNSITTPDESIEVGVKYFADMWKGHREYEILNIVQAYNFGGDFLS
HSGKSYSLESAIQFSKNQANGQKVTYTNPVAVRLGYDYRYAYGNMFYSQIVKQYISSDSSNTGTGRNSEI
AKIASDELAEGIHEGGEKYWRWYGFNSRVEWCATFVSYVAEKANVKMDRFAYCPTGINNFKANNQWQNGG
VEPRSGAIIFFDWDGDGISDHVGIVEKFENNTVHTIEGNSGDRIAKRTYEKSSPFILGYGMP
 
Nucleotide Sequence: 1029 bp     [Download]
>gi|116871422|ref|NC_008555.1|:812354-813382 Listeria welshimeri serovar 6b str. SLCC5334 chromosome, complete genome
ATGAAGATCTCTAAGCGTTTGGCGTTTTTTCTCGTTAGCTTCTTTTTTATCTTTATTTTATTGATTGGAG
GAACAAGTTCATCGACTAGTGTTACTGATACAGAAGAGGGACAAAATCTTCCAGAAGCGGTGCTTCGATG
GAAAGAAAAAGTAACTAAAGAAGCGGTTAAAAATGAAATATCAGAAGCCGTTCCCTATCTATTAGGAATT
ATTATGGTGGAGACGGGAGGGAATTCTGAAAAGTATCCCGATATTATGCAGTGTAGTGAAAGCCAAGGGA
GACAACCAAATTCCATAACAACCCCCGATGAATCAATAGAAGTTGGGGTTAAATACTTTGCGGATATGTG
GAAAGGGCATCGAGAGTATGAGATTTTAAACATTGTACAGGCGTACAATTTCGGAGGTGACTTTTTGAGT
CACTCTGGCAAAAGTTATTCATTAGAGAGTGCCATCCAGTTTTCCAAGAACCAAGCAAATGGACAGAAAG
TTACCTACACAAATCCAGTGGCAGTTAGATTAGGTTATGATTATCGCTATGCATATGGCAACATGTTTTA
CAGCCAAATTGTGAAGCAATATATATCTTCTGATTCTAGTAATACCGGCACTGGTAGAAATTCTGAGATT
GCTAAAATTGCATCAGATGAACTAGCAGAAGGCATTCATGAAGGAGGAGAAAAATACTGGCGTTGGTATG
GTTTTAATAGTCGTGTAGAATGGTGCGCCACTTTTGTTTCTTATGTGGCTGAAAAAGCAAATGTGAAAAT
GGACCGATTTGCCTATTGTCCAACAGGAATAAATAATTTTAAAGCGAATAATCAATGGCAGAATGGCGGA
GTAGAGCCAAGGAGTGGAGCAATTATTTTCTTTGATTGGGATGGTGATGGCATTAGTGATCATGTGGGAA
TTGTAGAGAAATTTGAAAATAATACAGTTCACACGATTGAAGGGAACTCTGGAGATAGGATTGCTAAACG
GACTTATGAAAAGAGTAGTCCGTTTATACTAGGATATGGGATGCCTTAA
 Primer design