SecReT4
Protein ID: 117676144
T4SS name [ID]Tra_F [576]
Gene symbol-
Locus tagShewana3_4204
StrainShewanella sp. ANA-3
Repliconplasmid 1 [GenBank: NC_008573] [Browse all T4SS(s) in this replicon]
Location [Strand]68453..70252 [-]
ProductUvrD/REP helicase
Component typeTraI_F
UniProt IDA0L2Y9
KEGG IDshn:Shewana3_4204
PDB IDNA
Domain hit(s) vs Pfam UvrD_C [PF13361], Evalue: 4.2e-35, Aligned region: 255..568
UvrD-helicase [PF00580], Evalue: 5.4e-29, Aligned region: 11..96
UvrD-helicase [PF00580], Evalue: 5.4e-29, Aligned region: 155..247
UvrD_C_2 [PF13538], Evalue: 1.2e-09, Aligned region: 496..564
AAA_19 [PF13245], Evalue: 5.5e-07, Aligned region: 18..83
Protein Sequence: 599 a.a.     [Download]
>gi|117676144|ref|YP_863720.1| UvrD/REP helicase [Shewanella sp. ANA-3]
MGSTKDQGLVIERDDNTLVCALPGSGKTYVLVELTKRLLSRDGAYSVHLLTFTDAARVELTERMLHALTP
RAMERVTISTFHSTALAMTRGKLNRRLLMANELMLFVKSVLNEADHLDLIDKFRFKVPDVVRLFDEMGRS
QDLSKEYSGTEVALYELYKDMLIKQGKTDFNVVCQLSVSWLAQREIPPVSATHILVDEFQDTDALQYMWL
REHALLGKKLVVVGDDDQAIYSFRGGQGYDNMVAFQSEFNADAYVLRDCFRCSKEILNRAGMLIKFNNPD
RIDKPMNAVREEQGTVKIIKSGTMDNQLNQILDAVSKEPHTWAVIARNNAILDRVETVIQGHGIEYNRRG
GKSFFDGVAPYSLIQIASVISGKHDDHTLHRALAALSVPEAETARIIGLCRTAKTTFGGLKHAEIGHHAD
LQKFHSLAEAWHDIPAGREDAKRTYMQSIVKLLAIHLDKRDQKHAQVVGDVIAGRHWESLGESIAQLKSS
LDCKKRKDQSEEAAPKLSLITMHSSKGLQFDNVWIVGSDTGTIPSKEALAEGKIAEERRLMYVAMTRAIS
SLTMSYTSEPSEFLYEVNKERVVELESGYEDDADDFDAA
 
Nucleotide Sequence: 1800 bp     [Download]
>gi|117676079|ref|NC_008573.1|:c70252-68453 Shewanella sp. ANA-3 plasmid 1, complete sequence
ATGGGCTCAACAAAAGATCAGGGGTTAGTCATCGAACGTGACGACAATACCCTTGTTTGTGCATTACCTG
GAAGTGGTAAAACCTATGTTTTGGTAGAGCTGACTAAGCGTTTACTGTCCAGAGATGGCGCCTATTCTGT
CCATTTACTTACGTTCACGGATGCGGCTCGTGTTGAGCTCACTGAGCGAATGCTTCACGCCCTTACCCCA
CGAGCTATGGAACGGGTAACTATCAGTACCTTTCATTCAACTGCGTTAGCGATGACTCGCGGCAAACTTA
ATCGCCGGTTATTAATGGCCAATGAGTTAATGCTGTTCGTTAAGTCGGTGCTCAATGAAGCTGACCATTT
AGACCTCATTGATAAGTTCAGATTTAAGGTGCCGGACGTTGTTAGGCTGTTTGATGAAATGGGCCGAAGC
CAAGACCTGTCAAAAGAGTATAGTGGCACAGAAGTTGCCTTGTACGAGCTTTACAAAGATATGCTGATTA
AGCAGGGCAAGACGGATTTTAACGTCGTATGCCAATTGTCCGTGAGCTGGCTGGCGCAAAGGGAAATCCC
TCCTGTGTCGGCTACGCATATTCTGGTAGACGAATTTCAAGATACCGATGCACTGCAATACATGTGGCTA
CGTGAACACGCGCTGCTTGGTAAAAAGCTGGTGGTCGTTGGTGATGACGATCAAGCTATCTACTCGTTTA
GGGGTGGCCAAGGATACGACAATATGGTGGCCTTTCAGTCAGAGTTTAACGCAGATGCTTACGTGTTAAG
AGACTGCTTTAGATGCTCAAAGGAAATCCTGAATCGAGCGGGGATGCTGATTAAGTTCAATAACCCCGAT
AGGATTGATAAGCCGATGAATGCGGTTAGGGAAGAGCAAGGTACTGTCAAAATCATTAAGTCTGGCACGA
TGGATAACCAGCTTAACCAGATTTTAGATGCGGTGAGCAAAGAGCCTCATACGTGGGCAGTAATTGCGAG
GAACAATGCCATCCTTGACCGCGTTGAAACGGTTATTCAGGGTCATGGCATTGAGTACAATCGACGCGGC
GGTAAGTCGTTTTTTGATGGCGTAGCACCCTACAGCTTGATTCAAATTGCCTCTGTGATTTCAGGCAAAC
ATGATGACCATACCCTGCATCGGGCTTTGGCGGCTTTGTCAGTGCCAGAGGCGGAAACGGCAAGAATTAT
TGGTTTATGCCGGACGGCGAAAACGACCTTTGGCGGCCTTAAACATGCGGAGATTGGTCATCATGCTGAC
CTGCAAAAGTTCCACTCATTAGCTGAAGCCTGGCATGACATACCTGCAGGGCGTGAGGATGCTAAGCGAA
CCTACATGCAATCTATCGTTAAATTGTTAGCCATACACCTCGATAAGCGCGACCAAAAACATGCTCAAGT
CGTCGGTGATGTCATTGCTGGACGTCACTGGGAGAGCCTGGGCGAAAGTATTGCGCAACTGAAGTCTTCG
TTAGACTGCAAAAAGCGTAAAGACCAATCAGAAGAGGCCGCACCTAAGCTGTCATTGATCACTATGCACT
CTTCAAAAGGTTTGCAGTTCGACAACGTGTGGATTGTGGGGAGCGACACAGGAACCATCCCGAGCAAAGA
GGCGTTAGCAGAGGGTAAGATAGCGGAAGAACGTCGATTAATGTATGTGGCCATGACCCGCGCTATCTCG
TCGCTCACTATGAGTTACACCAGTGAGCCCAGTGAGTTTCTGTACGAGGTTAACAAAGAAAGGGTTGTAG
AGCTGGAGTCTGGATATGAAGACGATGCTGACGATTTTGACGCCGCTTGA
 Primer design