SecReT4
Protein ID: 117676200
T4SS name [ID]Tra_F [576]
Gene symbol-
Locus tagShewana3_4261
StrainShewanella sp. ANA-3
Repliconplasmid 1 [GenBank: NC_008573] [Browse all T4SS(s) in this replicon]
Location [Strand]137972..138256 [-]
Producthypothetical protein
Component typeTraL_F
UniProt IDA0L345
KEGG IDshn:Shewana3_4261
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 6e-05, Aligned region: 4..71
Protein Sequence: 94 a.a.     [Download]
>gi|117676200|ref|YP_863776.1| hypothetical protein Shewana3_4261 [Shewanella sp. ANA-3]
MSEARFPKRCNGAIKVGTIHWDSIKLAVIVMVFGLASGHINLGIIAAITSMAVVETLFKKFGRGVLKHLL
WVNGLWISKGPETLMSPAIRRLIK
 
Nucleotide Sequence: 285 bp     [Download]
>gi|117676079|ref|NC_008573.1|:c138256-137972 Shewanella sp. ANA-3 plasmid 1, complete sequence
ATGAGTGAAGCGAGATTTCCTAAGCGTTGTAACGGCGCTATCAAAGTTGGAACTATCCACTGGGACTCAA
TCAAGCTGGCGGTGATTGTGATGGTTTTTGGTCTTGCATCAGGTCACATCAACTTAGGCATTATCGCGGC
AATTACCAGCATGGCCGTAGTAGAAACACTGTTTAAAAAGTTTGGGCGTGGCGTATTAAAGCATCTGTTA
TGGGTAAACGGTTTGTGGATTTCCAAAGGGCCGGAAACCCTCATGTCACCAGCCATTCGTCGATTAATTA
AGTAA
 Primer design