SecReT4
Protein ID: 117676209
T4SS name [ID]Tra_F [576]
Gene symbol-
Locus tagShewana3_4270
StrainShewanella sp. ANA-3
Repliconplasmid 1 [GenBank: NC_008573] [Browse all T4SS(s) in this replicon]
Location [Strand]147519..148514 [+]
Producthypothetical protein
Component typeTraF_F
UniProt IDA0L354
KEGG IDshn:Shewana3_4270
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 1.4e-46, Aligned region: 39..268
Thioredoxin_2 [PF13098], Evalue: 4e-08, Aligned region: 168..261
Thioredoxin_8 [PF13905], Evalue: 2.7e-06, Aligned region: 168..248
Redoxin [PF08534], Evalue: 3.9e-05, Aligned region: 153..197
Protein Sequence: 331 a.a.     [Download]
>gi|117676209|ref|YP_863785.1| hypothetical protein Shewana3_4270 [Shewanella sp. ANA-3]
MKVNKLMALIFAALALPVVAEDPANSNDGGNFYKQREKGWYWHEYIPEPEEKEEEEPIVPTPSSAPTETE
TSKNSVEAMSVKWFQENLPKAKELALNTGKPEDVKRYLYIQRAAIDRANQFAATYISEQMFDPYLDEGLR
RPENDVTLQTFKGAQSENQWKLIEAIGKKATLIYFYGSQCPYCAKQTPYLIRLAKEYGWSIMPVSLDGGT
VPNDDFLALGDYRVATSDMAQRFDVLATPTLYLTNNTGDYFLLGSGLIGMDSLSERIIELASREKIISQA
ELNNVKQVRALYMTDAEAKVDTQKVYEDPDYLINKMRNFMLGKPDSEGEQE
 
Nucleotide Sequence: 996 bp     [Download]
>gi|117676079|ref|NC_008573.1|:147519-148514 Shewanella sp. ANA-3 plasmid 1, complete sequence
ATGAAAGTAAATAAATTGATGGCTTTGATTTTTGCGGCTCTGGCTCTGCCAGTTGTGGCAGAAGATCCTG
CAAATAGCAATGATGGTGGTAACTTCTATAAACAACGCGAAAAGGGCTGGTATTGGCACGAGTACATTCC
TGAGCCCGAAGAAAAGGAAGAGGAAGAACCTATAGTGCCAACGCCATCTTCTGCACCAACTGAGACTGAA
ACGAGTAAAAATTCAGTAGAGGCCATGAGCGTTAAGTGGTTCCAAGAAAACTTGCCCAAGGCAAAGGAGT
TGGCGCTTAACACTGGAAAACCAGAAGACGTTAAACGCTACCTTTACATCCAGCGTGCCGCAATAGATCG
CGCCAACCAGTTTGCCGCTACTTATATTTCCGAACAAATGTTTGACCCTTACCTCGATGAAGGGTTACGC
CGTCCTGAAAACGACGTGACGCTGCAAACTTTCAAAGGCGCTCAGTCTGAAAACCAATGGAAGTTAATTG
AAGCCATCGGCAAGAAAGCCACCCTCATTTATTTCTACGGCTCTCAGTGTCCGTATTGCGCAAAGCAAAC
TCCCTACCTAATCCGTCTGGCAAAGGAATATGGATGGTCGATCATGCCCGTTTCTCTCGATGGCGGCACC
GTTCCAAATGATGACTTTTTAGCATTAGGCGATTATCGAGTGGCGACTTCCGACATGGCGCAGCGCTTCG
ACGTCTTGGCGACACCAACACTGTATCTAACCAACAACACGGGTGATTACTTCCTGTTGGGTTCTGGGCT
AATCGGCATGGATTCTCTCAGTGAAAGGATCATCGAACTCGCTAGCCGCGAGAAAATTATTAGCCAAGCA
GAACTTAATAATGTGAAGCAGGTACGAGCTCTGTATATGACCGATGCAGAAGCCAAGGTTGACACGCAAA
AAGTGTATGAAGACCCAGACTACCTCATTAACAAGATGCGGAATTTTATGCTCGGAAAACCTGATAGCGA
GGGTGAACAAGAATGA
 Primer design