SecReT4
Protein ID: 117919715
T4SS name [ID]Trb [304]
Gene symbol-
Locus tagShewana3_1267
StrainShewanella sp. ANA-3
Repliconchromosome 1 [GenBank: NC_008577] [Browse all T4SS(s) in this replicon]
Location [Strand]1480079..1480666 [+]
ProductTraF peptidase
Component typeTraF
UniProt IDA0KUN2
KEGG IDshn:Shewana3_1267
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 3.9e-54, Aligned region: 46..190
Protein Sequence: 195 a.a.     [Download]
>gi|117919715|ref|YP_868907.1| TraF peptidase [Shewanella sp. ANA-3]
MTAASTAGPASRSRSRLSVHILLIVLSVCGLAALAWASFVQPLPRLIYNPSDSVAVGWYRLDPLHHPSDS
LSHRAEVGSIVLTTLPPETAVLAAQRGYLPDHIPLLKRVGAVAPQHVCISADQVRIDGVPVAALLHTDRL
GRELQAWPHCRQLQPGELFLLSVTNPASFDSRYFGPVSVSAVIGIASPVWLEKRQ
 
Nucleotide Sequence: 588 bp     [Download]
>gi|117918459|ref|NC_008577.1|:1480079-1480666 Shewanella sp. ANA-3 chromosome 1, complete sequence
ATGACCGCTGCTTCTACTGCTGGCCCCGCATCGCGTTCTCGCTCGCGCCTGAGCGTGCACATCTTACTGA
TAGTTCTTTCCGTCTGCGGCTTGGCTGCATTGGCTTGGGCGTCCTTCGTGCAGCCGTTGCCACGCCTGAT
CTACAACCCGTCTGACAGCGTGGCAGTAGGCTGGTATCGCCTCGATCCGCTGCACCACCCCTCCGACTCG
CTATCACATAGGGCGGAAGTCGGCAGCATCGTCCTGACCACATTGCCGCCAGAAACGGCTGTGCTCGCCG
CGCAGCGTGGTTACCTGCCAGACCACATTCCATTGCTGAAACGTGTGGGTGCAGTCGCACCACAACATGT
ATGCATTTCGGCCGATCAGGTACGCATCGACGGTGTACCGGTGGCCGCTCTGTTGCACACCGATCGGCTT
GGCCGGGAGCTGCAAGCCTGGCCGCACTGCCGACAGCTTCAACCTGGCGAACTGTTCCTGTTGAGTGTGA
CCAACCCGGCGTCGTTTGACAGCCGCTATTTCGGCCCGGTCAGCGTGTCCGCCGTGATCGGTATTGCGAG
CCCTGTTTGGCTGGAGAAACGTCAATGA
 Primer design