SecReT4
Protein ID: 117919728
T4SS name [ID]Trb [304]
Gene symbol-
Locus tagShewana3_1280
StrainShewanella sp. ANA-3
Repliconchromosome 1 [GenBank: NC_008577] [Browse all T4SS(s) in this replicon]
Location [Strand]1491078..1493075 [+]
Productconjugal transfer coupling protein TraG
Component typeTraG
UniProt IDA0KUP5
KEGG IDshn:Shewana3_1280
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 3.6e-102, Aligned region: 112..558
TraG-D_C [PF12696], Evalue: 3e-31, Aligned region: 404..524
TrwB_AAD_bind [PF10412], Evalue: 2.2e-29, Aligned region: 173..539
Protein Sequence: 665 a.a.     [Download]
>gi|117919728|ref|YP_868920.1| conjugal transfer coupling protein TraG [Shewanella sp. ANA-3]
MQAQGVLFGQIAAVFGIVIAGVWGATQWTAAALGYQLRLGLPWFDLFGTPVYPPWKLFEWWFFFGAYAPE
VFDTGGAIAACSGLMAVVVAITMSVWRSRQSKRVTTYGSARWANASDIRKAKLSEPMGVFLGLHNDQYLR
HEGPEHVLAFAPTRSGKGVGLVVPTLLSWPASVVIHDIKGENWQLTAGWRSRFSHCLLFNPTDSNSAGYN
PLLEVRRGAHEVRDVQNIADILVDPEGALERRNHWEKTSHALLVGAILHVLYAGEDKTLCGVANFLSDPA
CPFELALHRMMTTKHLGDKPHPVVASAAREVLNKADNERSGVLSTAMSFLGLYRDPTVAEVTSRCDWRIA
DLIAAEHPVSLYLVVPPSDISRTKPLIRLILNQIGRRLTESLDGSDGIQRRHKLLLMLDEFPALGRLDFF
ETALAFMAGYGIRSFLIAQSLNQIDKAYGQNHSILDNCHVRVTFATNDERTAKRISETLGTATELRAQRN
YAGHRLAPWLGHLMVSRQETARPLLTPGEVMQLPPDESVVMVSSVAPIKAKKLRYYADANFKRRVLPPPT
LAAGQYADAPPSRLDDWGDLAIPTVPVALATASADDPGGADDGGLRRQPELSETVAYDPEPDAHASDLAL
LDDDDLPLPLPGQLDPAMQRTARLASLDPNDGIDL
 
Nucleotide Sequence: 1998 bp     [Download]
>gi|117918459|ref|NC_008577.1|:1491078-1493075 Shewanella sp. ANA-3 chromosome 1, complete sequence
ATGCAAGCTCAGGGCGTACTGTTTGGGCAGATCGCTGCCGTTTTCGGCATCGTGATCGCCGGTGTGTGGG
GAGCCACACAATGGACTGCCGCCGCTCTGGGCTATCAGCTACGCCTCGGTTTGCCTTGGTTTGATCTCTT
CGGCACACCGGTTTATCCCCCTTGGAAATTATTCGAATGGTGGTTCTTCTTTGGCGCTTACGCGCCGGAA
GTTTTCGACACCGGTGGAGCGATTGCCGCCTGCAGTGGCCTGATGGCCGTCGTCGTTGCCATCACCATGT
CGGTATGGCGTTCTCGGCAATCCAAGCGGGTCACCACCTATGGGTCAGCACGCTGGGCCAACGCCTCCGA
TATCCGTAAGGCCAAACTGTCCGAGCCGATGGGTGTTTTTCTCGGGCTGCACAACGACCAATACCTGCGC
CATGAAGGTCCAGAACATGTACTCGCCTTCGCACCGACGCGCTCCGGCAAGGGTGTTGGTCTTGTCGTCC
CAACGCTACTGTCTTGGCCCGCCTCTGTGGTTATCCACGACATCAAAGGTGAGAACTGGCAGCTCACTGC
CGGCTGGCGTTCGCGCTTCTCACACTGCCTACTGTTCAATCCCACCGATTCGAACTCGGCCGGCTACAAC
CCGTTGCTGGAAGTACGGCGTGGCGCGCATGAAGTGCGCGACGTGCAAAACATTGCCGACATCCTGGTTG
ATCCCGAAGGCGCGCTAGAGCGTCGCAATCACTGGGAAAAAACCAGTCATGCGCTGCTAGTGGGTGCCAT
CCTGCATGTGCTTTATGCAGGCGAAGACAAAACGCTGTGCGGTGTCGCCAATTTCCTGTCCGATCCGGCG
TGCCCGTTCGAACTGGCCCTGCACCGGATGATGACGACGAAGCACTTGGGCGATAAGCCGCATCCAGTGG
TGGCTTCTGCTGCACGGGAAGTTCTCAACAAGGCAGACAATGAGCGTTCGGGTGTGCTCTCCACTGCTAT
GTCCTTCCTGGGGTTGTACCGTGACCCCACGGTGGCAGAAGTCACGTCACGCTGTGACTGGCGCATCGCT
GATCTTATTGCGGCCGAGCACCCTGTTTCGTTGTACCTGGTGGTACCGCCATCGGACATCAGCCGGACTA
AACCGCTTATCCGGCTGATCCTCAACCAGATAGGGCGTCGGCTCACGGAGTCACTCGATGGCTCTGACGG
CATTCAAAGGCGCCACAAGCTGCTGCTAATGCTCGATGAGTTCCCGGCGCTTGGCCGGCTCGATTTCTTT
GAGACTGCTCTGGCTTTTATGGCCGGCTACGGCATCCGCAGCTTCCTCATCGCGCAAAGCCTGAACCAGA
TCGACAAGGCGTATGGGCAGAACCATTCGATTCTGGACAACTGCCATGTACGAGTGACGTTTGCCACCAA
CGACGAGCGTACCGCCAAGCGCATTTCCGAGACGTTGGGCACCGCCACCGAACTGCGCGCGCAGCGCAAC
TATGCCGGCCACCGGCTCGCGCCGTGGTTGGGCCATCTGATGGTGTCACGGCAGGAAACCGCACGGCCAC
TGCTGACGCCTGGCGAAGTGATGCAGCTTCCGCCAGACGAATCGGTGGTGATGGTGTCCAGCGTCGCGCC
GATCAAGGCGAAGAAATTGCGCTACTACGCCGACGCCAACTTCAAGCGCCGCGTACTACCGCCGCCCACG
CTGGCAGCCGGGCAGTACGCCGACGCGCCGCCATCGCGGCTCGACGACTGGGGCGACCTGGCGATCCCGA
CCGTGCCTGTGGCGCTGGCCACGGCATCCGCCGATGACCCCGGCGGCGCCGACGACGGCGGCCTGCGCCG
CCAGCCCGAACTCTCCGAAACCGTCGCCTACGACCCCGAGCCGGACGCACACGCTTCCGACCTCGCGCTG
CTCGATGACGACGACCTGCCGCTGCCGCTTCCCGGCCAGCTCGACCCGGCCATGCAGCGCACGGCCCGGC
TGGCTTCCCTCGACCCCAACGACGGAATCGACTTATGA
 Primer design