SecReT4
Protein ID: 117919730
T4SS name [ID]Trb [304]
Gene symbol-
Locus tagShewana3_1282
StrainShewanella sp. ANA-3
Repliconchromosome 1 [GenBank: NC_008577] [Browse all T4SS(s) in this replicon]
Location [Strand]1493533..1494603 [+]
Producttype II secretion system protein E
Component typeTrbB
UniProt IDA0KUP7
KEGG IDshn:Shewana3_1282
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.2e-81, Aligned region: 33..299
TrwB_AAD_bind [PF10412], Evalue: 4.1e-06, Aligned region: 155..192
FtsK_SpoIIIE [PF01580], Evalue: 1.1e-05, Aligned region: 152..222
AAA_19 [PF13245], Evalue: 9.9e-05, Aligned region: 151..192
Protein Sequence: 356 a.a.     [Download]
>gi|117919730|ref|YP_868922.1| type II secretion system protein E [Shewanella sp. ANA-3]
MSAVPQIPPQPRSSAATSLDRRIQMLRTAMGPLIATALEDPDVVEIMLNPDRTLWVDRLSSGRAPLGVEL
PEADGERIIRLVAAHVGAEVHRGQPLLTAELPETGERFEGILPPAAPGPAFALRKRAVNIIGLDQYVADG
ILTAGQADFLRRAVRERQNVLIAGGTSTGKTTLANALLAEIAATGDRVLVLEDTIELQCAARDHVPLRTR
AGVVSMQELVRATMRLRPDRVVVGEVRGGEALDLIKVWGTGHPGGIATIHAGSALGALLRLEQLILEVAV
NPPRALIAEAVNVVIHIAGRGRKRHVETIARVVGFDGTGYRLADALETPFPELIPLPLAADAAALPPSPD
QPGELP
 
Nucleotide Sequence: 1071 bp     [Download]
>gi|117918459|ref|NC_008577.1|:1493533-1494603 Shewanella sp. ANA-3 chromosome 1, complete sequence
ATGAGCGCCGTTCCGCAGATCCCGCCTCAACCTCGTTCGTCCGCCGCAACCTCACTGGATCGACGAATCC
AGATGCTGCGCACGGCAATGGGGCCGCTGATTGCCACCGCGCTCGAAGACCCGGACGTGGTGGAAATCAT
GCTCAACCCCGACCGCACCCTATGGGTGGATCGGCTGTCGTCGGGCCGCGCACCGCTGGGCGTGGAACTG
CCCGAAGCCGATGGCGAACGCATCATCCGCCTGGTGGCTGCGCACGTCGGTGCGGAAGTGCATCGCGGCC
AGCCGCTGCTAACCGCCGAGCTGCCGGAGACGGGCGAACGCTTCGAGGGCATCTTGCCGCCAGCCGCTCC
CGGCCCGGCCTTCGCGCTGCGCAAGCGTGCCGTGAACATCATCGGCCTGGATCAGTATGTGGCCGACGGC
ATCCTGACCGCTGGCCAGGCGGACTTCCTGCGCCGCGCCGTGCGCGAGCGCCAGAACGTACTGATCGCCG
GCGGCACCAGTACCGGCAAGACCACCCTCGCCAACGCTTTGCTGGCCGAGATCGCCGCCACCGGCGACCG
CGTGCTGGTGCTCGAAGACACCATCGAGCTGCAATGCGCAGCCCGTGACCATGTGCCGCTGCGCACCCGT
GCGGGCGTGGTGTCGATGCAGGAACTGGTGCGCGCCACGATGCGCCTGCGCCCGGATCGCGTCGTCGTCG
GCGAAGTACGCGGCGGCGAAGCCCTCGACCTCATCAAAGTGTGGGGAACAGGCCACCCCGGCGGCATCGC
CACCATCCACGCCGGTTCCGCGCTAGGCGCTTTGCTGCGCCTCGAACAGTTGATCCTCGAAGTCGCAGTG
AATCCGCCACGGGCGCTGATCGCCGAGGCGGTCAACGTCGTCATCCACATCGCCGGACGTGGCCGCAAGC
GCCACGTCGAAACCATCGCCCGTGTCGTCGGCTTCGACGGCACCGGCTATCGCCTGGCGGACGCGCTGGA
AACGCCGTTTCCCGAATTGATCCCGCTTCCGCTCGCAGCCGACGCCGCTGCGCTTCCCCCGTCCCCTGAC
CAACCTGGAGAACTGCCATGA
 Primer design