SecReT4
Protein ID: 117919733
T4SS name [ID]Trb [304]
Gene symbol-
Locus tagShewana3_1285
StrainShewanella sp. ANA-3
Repliconchromosome 1 [GenBank: NC_008577] [Browse all T4SS(s) in this replicon]
Location [Strand]1495263..1497713 [+]
Productconjugal transfer ATPase TrbE
Component typeTrbE
UniProt IDA0KUQ0
KEGG IDshn:Shewana3_1285
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.7e-36, Aligned region: 442..711
CagE_TrbE_VirB [PF03135], Evalue: 9.1e-16, Aligned region: 299..388
DUF853 [PF05872], Evalue: 3.9e-07, Aligned region: 601..684
TraG-D_C [PF12696], Evalue: 5.8e-05, Aligned region: 644..708
Protein Sequence: 816 a.a.     [Download]
>gi|117919733|ref|YP_868925.1| conjugal transfer ATPase TrbE [Shewanella sp. ANA-3]
MLNLAEYRQRPALLADWLPWAGLIAPGVVLNKDGSFQRTARFRGPDLDSATQGELIAASARLNNALRRLG
SGWALFIEAERRPAAGYPHSDFPEPLSWLVDEERRAAFEESGHHFESGYHLTMVFLPPEESRARAAKLLY
ENSPGDGVDWRGRLDAFVAETDRVFDLLDGVMPEIAWLDDDDTLTGLHATVSTRRYRLGVPEVPFHIDAL
LADCALVGGLAPMLGDQHLRVVSVRGFPTSTWPGILDDLNRLGFGYRWSTRFLCMDKAEAEKELGRLRRQ
WFAKRKNVVALLRETIFQQESPLVDTDASNKAADADAALQELGSDQVAFGYLTATVTVLDADPAVADEKL
RMVERVIQGRGFVTIPETLNAVDAWLSSIPGNAYANVRQPIFSTLNLAHMMPLSAVWAGPEKNDHLDGPP
LIVTRTDGATPFRLVTHIGDVGHTLVAGPTGMGKSVLLAILAMQFRRYFGSRIFAFDMGRSMRATILGLG
GEHYDLGADGGIAFQPLARIDSEGYRTWAAEWVEGRLLHEGVTVGPDEKAAIWSALGSLAGAPVEQRTLT
GLSVLLQSNALRQALSPYVLGGAHGKLLDADRDRLGMADVQGFEMEELMHSPAAVQAVLRYLFARFDERF
DGAPTLLILDEAWLFLDEPSFAARIRQWLKTLRKKNVSVIFATQSLADIKDSTIAPAIIESCASRIFLPN
PQATEPQIRTIYEGFGLNSRQIEIVATAQPKRDYYYQSRLGNRLFDLDLGPLALAFAGASTPQDQRDIDR
VLTQAGAPGFTGAWLRHRGLDWAADLLPSSPAAASFLNSQPLEVSP
 
Nucleotide Sequence: 2451 bp     [Download]
>gi|117918459|ref|NC_008577.1|:1495263-1497713 Shewanella sp. ANA-3 chromosome 1, complete sequence
ATGCTGAACCTTGCCGAATACCGCCAGCGGCCCGCGCTGCTGGCCGACTGGCTTCCCTGGGCCGGGCTGA
TCGCGCCGGGCGTTGTGCTGAACAAGGATGGCTCTTTCCAGCGCACGGCACGTTTTCGCGGGCCGGACTT
GGACAGCGCCACGCAAGGCGAGTTGATCGCCGCATCCGCGCGGCTCAACAACGCGCTGCGCCGCCTGGGT
TCGGGCTGGGCCTTGTTCATCGAGGCCGAGCGCCGACCGGCTGCGGGCTATCCGCACTCGGATTTTCCCG
AGCCGCTGTCCTGGTTGGTGGACGAGGAACGCCGCGCCGCCTTCGAGGAATCGGGCCATCACTTCGAGAG
CGGTTATCACCTGACGATGGTGTTTCTCCCGCCGGAGGAATCGCGCGCCCGCGCTGCCAAGCTGCTCTAC
GAGAACTCGCCCGGCGACGGCGTGGACTGGCGTGGTCGGCTCGATGCCTTCGTGGCTGAAACCGATCGCG
TGTTCGATCTGCTCGATGGCGTGATGCCGGAAATCGCCTGGCTCGATGACGACGACACGCTGACCGGCCT
GCACGCGACGGTTTCGACGCGGCGCTACCGGCTCGGCGTACCCGAAGTACCGTTCCATATCGACGCGCTA
CTGGCCGACTGCGCCCTGGTCGGTGGCCTTGCGCCGATGCTGGGCGACCAGCACCTGCGGGTGGTGTCGG
TGCGTGGCTTTCCGACCTCGACCTGGCCGGGGATTCTGGACGACCTCAACCGCCTGGGCTTTGGCTACCG
CTGGAGCACACGCTTTCTCTGCATGGACAAAGCCGAGGCCGAAAAGGAACTCGGCCGCCTGCGCCGCCAG
TGGTTCGCCAAGCGCAAGAACGTCGTCGCACTGCTGCGCGAAACGATCTTCCAGCAGGAAAGCCCGCTGG
TGGATACCGACGCCAGCAACAAGGCCGCCGACGCCGATGCGGCCTTGCAGGAGTTGGGCAGCGATCAAGT
CGCGTTCGGCTATCTCACCGCCACGGTGACAGTGCTCGACGCCGACCCGGCAGTGGCCGACGAGAAGCTG
CGCATGGTGGAGCGCGTCATCCAGGGTCGGGGCTTCGTGACGATTCCCGAAACCTTGAACGCGGTCGATG
CCTGGCTGTCGTCCATCCCCGGCAACGCTTACGCGAACGTGCGCCAGCCCATCTTCTCGACGCTGAACCT
GGCGCACATGATGCCGCTGTCGGCGGTGTGGGCCGGGCCGGAGAAGAACGACCATCTGGACGGCCCGCCG
CTGATCGTCACCCGCACCGATGGCGCGACGCCTTTTCGCTTGGTCACGCACATCGGCGACGTGGGCCACA
CACTGGTCGCCGGGCCGACCGGCATGGGCAAGTCGGTACTGCTTGCCATTCTGGCCATGCAGTTCCGGCG
CTACTTCGGCTCGCGGATCTTCGCCTTCGACATGGGCCGCTCCATGCGTGCCACCATCCTCGGCCTCGGC
GGCGAACACTACGACCTCGGCGCCGATGGCGGCATCGCCTTTCAGCCGTTGGCCCGTATCGACAGCGAGG
GCTACCGCACCTGGGCGGCTGAATGGGTGGAAGGCCGGCTACTGCACGAAGGCGTGACCGTCGGCCCCGA
CGAGAAGGCAGCCATCTGGTCGGCGCTGGGTAGCCTCGCCGGTGCGCCGGTGGAACAGCGCACGCTGACC
GGGCTTTCCGTGCTGCTGCAATCGAACGCGCTACGGCAAGCGCTGTCGCCCTATGTGCTTGGCGGCGCCC
ACGGCAAGCTGCTGGACGCCGACCGCGACCGGCTGGGCATGGCCGACGTGCAGGGCTTCGAGATGGAAGA
ACTGATGCACAGCCCCGCCGCCGTGCAAGCGGTGCTGCGCTACCTGTTCGCCCGCTTCGATGAGCGTTTC
GATGGTGCGCCCACGCTGCTGATTCTGGATGAAGCCTGGCTGTTCCTCGATGAGCCATCTTTCGCGGCCC
GCATCCGGCAATGGCTCAAGACGCTCAGGAAAAAGAACGTCAGCGTCATCTTCGCCACGCAGAGCCTGGC
AGACATCAAGGACTCGACCATCGCGCCCGCGATCATCGAGAGCTGCGCCAGTCGGATTTTCTTGCCTAAC
CCGCAGGCGACCGAGCCGCAGATTCGCACGATCTATGAGGGTTTCGGGCTCAACAGCCGGCAGATCGAGA
TCGTCGCCACCGCGCAGCCCAAGCGCGACTACTACTACCAGTCGCGTCTCGGCAACCGCCTATTCGACCT
CGACCTGGGGCCGTTGGCGCTCGCCTTCGCGGGCGCATCCACCCCTCAAGACCAACGCGACATCGACCGC
GTGTTGACGCAGGCCGGCGCCCCCGGCTTCACCGGCGCGTGGCTGCGCCATCGCGGCCTCGACTGGGCCG
CCGACCTGCTGCCGTCCTCACCGGCGGCCGCTTCGTTTCTCAACTCCCAACCACTGGAGGTTTCACCATG
A
 Primer design