SecReT4
Protein ID: 117919734
T4SS name [ID]Trb [304]
Gene symbol-
Locus tagShewana3_1286
StrainShewanella sp. ANA-3
Repliconchromosome 1 [GenBank: NC_008577] [Browse all T4SS(s) in this replicon]
Location [Strand]1497710..1498453 [+]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDA0KUQ1
KEGG IDshn:Shewana3_1286
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 247 a.a.     [Download]
>gi|117919734|ref|YP_868926.1| conjugal transfer protein TrbJ [Shewanella sp. ANA-3]
MKTKPRLLSVSLAAVLSVSLLAVQPASALTVFDPSNFVQNTLTAIRTLEQINNQINQLQNEAQMLMNQAR
NLAKLDFNIVNRLRSTLATTERLIAEARGLAYDVQSMDATFARLYPEQYAATISGDRMAQDARERWQNTL
NGLHTAMRMQAQVSQNLAQDESALADLVSQSQSATGALQAMQATNQLLALQAKQSIQAQQLQITQDRAAS
LELARQAAATERAREVRRRFLGTGTPYTPQSVNFYNN
 
Nucleotide Sequence: 744 bp     [Download]
>gi|117918459|ref|NC_008577.1|:1497710-1498453 Shewanella sp. ANA-3 chromosome 1, complete sequence
ATGAAGACTAAGCCCCGTTTGCTGTCCGTCTCGCTCGCCGCCGTGCTGTCGGTATCGCTGCTGGCCGTGC
AGCCCGCGTCCGCGCTGACGGTGTTCGACCCGTCGAACTTCGTGCAGAACACGCTGACAGCCATCCGCAC
GCTGGAGCAGATCAACAACCAGATCAACCAGCTCCAGAACGAAGCGCAGATGCTGATGAACCAGGCGCGC
AATCTGGCGAAGCTGGACTTCAACATCGTCAATCGGCTGCGCTCGACGCTCGCCACCACTGAGCGCCTGA
TCGCCGAGGCACGCGGCCTGGCCTACGACGTGCAGAGCATGGACGCCACGTTCGCCCGCCTGTACCCGGA
GCAATATGCCGCCACTATCAGCGGCGACCGCATGGCGCAGGACGCCCGCGAACGCTGGCAGAACACCTTG
AACGGTCTGCACACCGCGATGCGGATGCAGGCGCAGGTGTCGCAAAACCTTGCTCAAGACGAAAGTGCGC
TGGCCGACCTCGTGAGCCAGAGCCAGTCGGCCACCGGCGCGCTGCAAGCCATGCAGGCGACGAATCAGCT
TCTCGCCTTGCAGGCCAAGCAGTCGATCCAGGCGCAGCAGCTCCAGATCACGCAAGACCGGGCCGCTTCG
CTGGAACTGGCGCGGCAGGCGGCGGCGACCGAACGCGCCCGCGAAGTGCGGCGGCGCTTCCTCGGCACCG
GCACACCGTACACGCCGCAGTCCGTCAACTTCTACAACAACTGA
 Primer design