SecReT4
Protein ID: 117919736
T4SS name [ID]Trb [304]
Gene symbol-
Locus tagShewana3_1288
StrainShewanella sp. ANA-3
Repliconchromosome 1 [GenBank: NC_008577] [Browse all T4SS(s) in this replicon]
Location [Strand]1498780..1500162 [+]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDA0KUQ3
KEGG IDshn:Shewana3_1288
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 3.4e-50, Aligned region: 37..264
Protein Sequence: 460 a.a.     [Download]
>gi|117919736|ref|YP_868928.1| conjugal transfer protein TrbL [Shewanella sp. ANA-3]
MNDVTIIDRFLDTFSRYIDSGFGLLQGEVAFLTATLIVIDMTIAGLYWAMSHATGQGEDVIAKLLRKVLY
VGAFAYIIGNFNWLASIVFRSFAGLGITATGSAITMENFLQPGRLAKTGIDAGAPILEQIGDMAGFPEVF
VNIDPIVVMFLAWLVVILCFFVLAVQLFITLIEFKLTTLAGFVLVPFALWNKTSFLAEKVLGNVVSSGIK
VLVLAVIVGIGSGLFAEFQAHPDEPSIDHALVVMLASLALLALGIFGPGIATGLVSGAPQLGAGAMAGAA
VGAVGTGVAIGAAATGVGAAVAAGARMAPAAAKLAGAGARAATSAAGNARSAFQAGSTAAGGGAKGAAAG
LGNVAKTSAQAASRRVASGASAAGQKMTSSFRAGWNGSSDDAGAAAAGQSAASEAADGAANSQKQEQPAW
AKRMHRRQQITHAATTTAHTLRGGDGGGSGQGPSLRDSDT
 
Nucleotide Sequence: 1383 bp     [Download]
>gi|117918459|ref|NC_008577.1|:1498780-1500162 Shewanella sp. ANA-3 chromosome 1, complete sequence
ATGAACGACGTGACCATCATCGACCGTTTCCTCGATACGTTCTCGCGCTACATCGACTCGGGCTTCGGGC
TGCTACAAGGCGAAGTGGCGTTTCTCACCGCCACGCTCATCGTCATCGACATGACGATCGCGGGACTGTA
CTGGGCCATGAGCCACGCCACCGGCCAGGGCGAGGACGTGATCGCCAAGCTGCTGCGCAAGGTGCTCTAC
GTCGGCGCCTTCGCCTACATCATCGGCAACTTCAACTGGCTGGCGAGCATCGTGTTCCGCTCGTTCGCCG
GCCTGGGAATCACGGCCACCGGATCGGCCATCACGATGGAGAATTTTCTTCAGCCGGGGCGGCTGGCGAA
AACCGGCATTGACGCAGGAGCACCGATTCTGGAACAGATCGGGGACATGGCCGGGTTCCCCGAGGTGTTC
GTGAACATCGACCCCATCGTGGTGATGTTCCTCGCCTGGCTGGTGGTGATCCTCTGCTTCTTCGTGCTGG
CGGTGCAGCTTTTCATCACGCTGATCGAGTTCAAGCTGACCACGCTCGCCGGCTTCGTGCTGGTGCCGTT
CGCGCTGTGGAACAAGACGAGCTTCCTGGCGGAAAAGGTGCTCGGCAACGTGGTGTCTTCGGGCATCAAA
GTCTTGGTGCTGGCCGTCATCGTCGGCATCGGTTCGGGTCTGTTCGCCGAGTTCCAAGCGCATCCCGATG
AACCATCCATCGACCATGCGCTGGTCGTGATGCTGGCCTCGCTCGCGCTGCTGGCGCTGGGCATCTTCGG
CCCCGGCATCGCCACCGGCCTGGTGTCCGGTGCGCCTCAGCTTGGCGCGGGCGCGATGGCCGGTGCTGCT
GTCGGCGCTGTCGGCACGGGCGTCGCCATCGGTGCCGCCGCGACCGGCGTGGGCGCCGCCGTAGCCGCCG
GGGCACGCATGGCGCCAGCCGCCGCGAAGCTGGCCGGTGCCGGGGCGCGTGCCGCCACCTCAGCGGCTGG
CAACGCGCGGTCGGCGTTCCAGGCGGGTTCCACCGCTGCGGGCGGCGGGGCCAAAGGCGCGGCGGCTGGC
CTTGGCAATGTCGCCAAGACCAGCGCACAGGCCGCCAGCCGCCGCGTCGCTTCTGGTGCTTCCGCAGCAG
GGCAGAAGATGACCAGTTCCTTTCGTGCCGGCTGGAACGGATCTTCGGACGATGCCGGTGCAGCCGCGGC
GGGCCAATCCGCCGCAAGCGAGGCCGCAGACGGCGCTGCCAACTCGCAGAAGCAAGAGCAACCCGCCTGG
GCCAAGCGGATGCACCGCCGCCAGCAGATCACCCATGCCGCGACCACCACCGCCCACACGCTGCGCGGTG
GCGACGGCGGCGGCTCAGGGCAAGGCCCGAGCCTGCGCGATTCCGATACCTGA
 Primer design