SecReT4
Protein ID: 117919737
T4SS name [ID]Trb [304]
Gene symbol-
Locus tagShewana3_1289
StrainShewanella sp. ANA-3
Repliconchromosome 1 [GenBank: NC_008577] [Browse all T4SS(s) in this replicon]
Location [Strand]1500181..1500885 [+]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDA0KUQ4
KEGG IDshn:Shewana3_1289
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2.1e-61, Aligned region: 22..225
Protein Sequence: 234 a.a.     [Download]
>gi|117919737|ref|YP_868929.1| conjugal transfer protein TrbF [Shewanella sp. ANA-3]
MRFKRPQVRYADTPQPATPYQAAAQVWDERIGSARVQAKNWRLMAFGCLVLALLMAGGLVWRSAQSIVTP
YVIEVDQAGQVRAVGEAATPYRPADAQIAHHLARFVSLVRSLSIDPIVVRQNWLDAYDYTTDRGAAVLND
YARTNDPFARIGKESVTVQITSVVRASDTSFNVRWTEQRFVNGAPAGTERWNAVLSTVLQTPRTEQRLRK
NPLGIYVNGLSWSRELDSSEGAKP
 
Nucleotide Sequence: 705 bp     [Download]
>gi|117918459|ref|NC_008577.1|:1500181-1500885 Shewanella sp. ANA-3 chromosome 1, complete sequence
ATGCGATTCAAACGACCGCAGGTGCGCTACGCCGATACGCCGCAGCCTGCCACCCCGTATCAAGCCGCCG
CCCAGGTGTGGGACGAGCGTATCGGCTCGGCCCGCGTGCAGGCCAAGAACTGGCGGCTGATGGCCTTCGG
CTGCCTGGTGCTCGCGCTACTGATGGCCGGTGGCCTGGTATGGCGCTCGGCGCAGTCCATCGTGACGCCT
TACGTCATCGAGGTCGATCAGGCCGGACAGGTTCGCGCCGTGGGCGAGGCCGCCACGCCGTACCGGCCCG
CCGATGCGCAGATCGCGCACCACCTGGCACGCTTCGTCAGCCTGGTGCGCTCGCTGTCCATCGACCCCAT
CGTCGTGCGGCAAAACTGGCTCGATGCCTACGACTACACCACCGACCGGGGCGCGGCCGTGCTCAACGAC
TACGCCCGCACCAATGATCCATTCGCTCGCATCGGCAAGGAATCGGTGACGGTGCAGATCACCAGCGTGG
TGCGTGCCAGCGACACGTCTTTCAACGTGCGCTGGACGGAGCAACGGTTCGTCAATGGCGCACCCGCTGG
CACCGAACGCTGGAACGCCGTGCTTTCCACCGTCCTGCAAACCCCGCGCACCGAACAGCGCCTGCGCAAG
AACCCGTTGGGTATCTACGTCAACGGCCTGTCGTGGAGCCGCGAACTGGATTCTTCCGAAGGAGCCAAGC
CATGA
 Primer design