SecReT4
Protein ID: 117919738
T4SS name [ID]Trb [304]
Gene symbol-
Locus tagShewana3_1290
StrainShewanella sp. ANA-3
Repliconchromosome 1 [GenBank: NC_008577] [Browse all T4SS(s) in this replicon]
Location [Strand]1500882..1501874 [+]
Productconjugal transfer protein TrbG/VirB9/CagX
Component typeTrbG
UniProt IDA0KUQ5
KEGG IDshn:Shewana3_1290
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 9.9e-66, Aligned region: 103..322
Protein Sequence: 330 a.a.     [Download]
>gi|117919738|ref|YP_868930.1| conjugal transfer protein TrbG/VirB9/CagX [Shewanella sp. ANA-3]
MNLPFRFHALPLILLALAGCASQGKPPPTISLDESVLAQPLPEPLAPVEVVAVPEPLALPAQLKPLPEVD
AAPAAPEPADEKVRVSRANAEARIAPTREGYVNAIQVWPFTDGALYQVYASPGRVTVVSLQPGEELVTVA
AGDTVRWIVGDTSSGSSDALRVNVLVKPIRSGLKTNLVITTSRRTYLLELTSTEKAWMASVSWDYPRDRM
LALQRQSQAASAAAPVDTGLALEKIRFRYAVSGSNPPWKPLRAFDDGEKVYIQFPAGIAQGELPPLFVIG
VQGDGQLVNYRFRSPYYIVDRLFGAAELRLGGDGGDVVRIERTDGVARRN
 
Nucleotide Sequence: 993 bp     [Download]
>gi|117918459|ref|NC_008577.1|:1500882-1501874 Shewanella sp. ANA-3 chromosome 1, complete sequence
ATGAACCTGCCTTTCCGCTTTCACGCTTTGCCGTTGATCCTGCTTGCCCTCGCGGGCTGCGCCTCGCAGG
GCAAGCCGCCGCCGACCATCTCACTTGATGAGTCAGTGCTGGCCCAGCCGCTGCCCGAACCGCTCGCGCC
GGTGGAAGTCGTCGCCGTCCCCGAGCCGCTGGCGTTGCCGGCGCAGTTGAAGCCACTGCCGGAGGTCGAT
GCGGCCCCGGCTGCGCCGGAGCCAGCCGACGAGAAGGTACGTGTTTCCCGTGCCAACGCCGAGGCACGCA
TCGCACCCACACGCGAGGGCTACGTCAATGCTATCCAGGTGTGGCCTTTCACCGATGGTGCGCTTTATCA
GGTCTATGCCTCGCCGGGGCGCGTGACCGTGGTTTCGCTCCAGCCGGGCGAGGAACTGGTGACGGTCGCC
GCCGGCGATACCGTGCGCTGGATCGTGGGCGACACGTCCAGCGGCAGCAGCGACGCGCTGCGCGTTAATG
TGCTGGTCAAGCCCATCCGCTCGGGCCTGAAAACCAATCTGGTCATCACCACCAGCCGGCGCACCTACCT
GCTGGAGCTGACCTCAACGGAAAAGGCATGGATGGCCTCGGTATCCTGGGACTATCCACGCGACCGGATG
CTGGCCTTGCAGCGCCAGTCGCAGGCGGCCAGCGCCGCCGCGCCAGTCGATACCGGCCTGGCGTTGGAGA
AGATCCGCTTCCGTTACGCGGTATCGGGCAGCAACCCGCCGTGGAAGCCGCTGCGTGCCTTCGATGACGG
CGAGAAGGTCTATATCCAGTTTCCGGCGGGCATTGCCCAGGGCGAGCTGCCGCCGCTGTTCGTCATCGGC
GTGCAGGGCGACGGGCAACTGGTGAATTATCGTTTCCGCTCGCCGTACTACATCGTGGATCGCCTGTTCG
GCGCGGCCGAACTGCGGCTGGGCGGCGATGGCGGCGACGTGGTGCGGATCGAGCGCACCGATGGCGTGGC
GCGGAGGAACTGA
 Primer design