SecReT4
Protein ID: 117919739
T4SS name [ID]Trb [304]
Gene symbol-
Locus tagShewana3_1291
StrainShewanella sp. ANA-3
Repliconchromosome 1 [GenBank: NC_008577] [Browse all T4SS(s) in this replicon]
Location [Strand]1501877..1503157 [+]
Productconjugation TrbI family protein
Component typeTrbI
UniProt IDA0KUQ6
KEGG IDshn:Shewana3_1291
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.5e-58, Aligned region: 230..412
Protein Sequence: 426 a.a.     [Download]
>gi|117919739|ref|YP_868931.1| conjugation TrbI family protein [Shewanella sp. ANA-3]
MSQDDTPDLAAPPAGKVAPEAVALRAQPRPVTRLNRRTLAILAGGLSVAVLGATIWSLQPHRRGTGEQTE
LYNVDRVSKSEGLDALPTDYSKLPPALPHDVPELGPPLPGDLGPAIVKSQQPVTAAYAAPGHDPNDALRK
EAEAAAASSVFFRSGAQAAAPVAQSQAATAPGFAANAAFDPMAAGPASTAAQPADPTAVQNRQDQKEAFL
KGGSTETRNSGNLTLPASPYQVMAGTVVAGALVTGIKSDLPGDVIATVTEPVYDTATGRFLLIPQGSRIL
GKYNSQVSYGQSRVQVVWNRIILPDTSSLTLDNLAGADPAGYAGLEDDVDYHWGRIFAGAALTTLLGVGA
ELAAPENRQDGDRVIIAGRDSLQDTVNQIGQEVTRRNLNIQPTLTQRPGLPVRIIVNRDLVLRPYQPLFF
NRGTSR
 
Nucleotide Sequence: 1281 bp     [Download]
>gi|117918459|ref|NC_008577.1|:1501877-1503157 Shewanella sp. ANA-3 chromosome 1, complete sequence
ATGAGCCAGGATGACACTCCCGACCTCGCCGCTCCGCCGGCGGGCAAGGTGGCGCCCGAGGCTGTGGCGC
TGCGTGCCCAGCCGCGTCCGGTCACGCGCCTGAACCGGCGCACGCTGGCCATCCTCGCGGGCGGCCTGTC
GGTCGCCGTGCTTGGGGCCACGATCTGGTCGCTGCAACCGCATCGGCGCGGTACGGGCGAGCAAACCGAG
CTTTACAACGTCGATCGCGTCTCGAAGTCCGAAGGGCTGGATGCGCTACCGACGGACTACTCGAAGCTGC
CGCCAGCCTTGCCGCACGATGTACCCGAGCTGGGGCCGCCGCTGCCGGGCGACCTCGGCCCGGCCATCGT
GAAGTCGCAGCAGCCGGTGACAGCCGCCTACGCGGCTCCCGGCCACGACCCGAACGATGCGCTGCGCAAG
GAAGCCGAAGCTGCCGCAGCATCGTCCGTGTTCTTCCGCTCGGGTGCGCAGGCGGCCGCGCCGGTCGCGC
AGTCGCAGGCCGCCACCGCGCCGGGCTTCGCCGCCAATGCGGCGTTCGACCCGATGGCCGCCGGGCCGGC
CTCGACGGCGGCCCAGCCTGCCGATCCGACCGCCGTGCAGAACCGGCAAGACCAGAAGGAGGCTTTCCTG
AAAGGCGGCTCTACGGAAACCCGCAATTCCGGCAACCTGACCCTGCCGGCTTCGCCGTATCAGGTCATGG
CCGGAACGGTGGTTGCCGGAGCGCTGGTGACGGGCATCAAGTCGGACTTGCCCGGCGACGTGATCGCCAC
TGTGACAGAGCCGGTCTATGACACGGCCACCGGGCGTTTCCTGCTGATCCCGCAGGGTTCGCGCATCCTG
GGCAAATACAACAGCCAGGTCAGTTACGGGCAGAGCCGCGTTCAAGTCGTCTGGAATCGGATCATTCTGC
CGGACACGTCTTCGTTGACGCTCGACAATCTGGCCGGCGCAGATCCGGCCGGCTATGCCGGCCTGGAAGA
CGATGTGGACTACCACTGGGGCCGCATCTTTGCCGGTGCGGCGCTGACGACCCTGCTGGGCGTCGGCGCC
GAACTGGCCGCGCCGGAGAATCGACAAGATGGCGATCGCGTCATCATCGCCGGGCGTGACAGTTTGCAGG
ACACGGTGAATCAAATCGGCCAGGAAGTGACCCGGCGCAACCTCAACATCCAGCCCACCTTGACCCAACG
GCCCGGCCTGCCGGTGCGGATCATCGTCAACCGCGACTTGGTGTTGCGGCCGTACCAGCCGCTGTTCTTC
AATCGGGGGACTTCACGATGA
 Primer design