SecReT4
Protein ID: 118577371
T4SS name [ID]Tra_F [802]
Gene symbol-
Locus tagPpro_3769
StrainPelobacter propionicus DSM 2379
Repliconplasmid pPRO1 [GenBank: NC_008607] [Browse all T4SS(s) in this replicon]
Location [Strand]144094..144480 [-]
Producttype IV secretory protease
Component typeTraF_F
UniProt IDA0R7Q0
KEGG IDppd:Ppro_3769
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 1.2e-12, Aligned region: 3..128
Protein Sequence: 128 a.a.     [Download]
>gi|118577371|ref|YP_899611.1| type IV secretory protease [Pelobacter propionicus DSM 2379]
MSITKSLSHRLYWLDKDTAKIKYGDYVLFRHSDVATQFIEQTMIKLVKCDEGDVLTVNEKKELYCNNAFI
GRAKDKALNGKKLVNFVWNGPVPPGMFLPMGDHKDSYDGRYYGFLPKSKVLKKAHPVF
 
Nucleotide Sequence: 387 bp     [Download]
>gi|118577231|ref|NC_008607.1|:c144480-144094 Pelobacter propionicus DSM 2379 plasmid pPRO1, complete sequence
GTGAGCATCACCAAATCTCTGAGCCACAGACTGTATTGGCTTGATAAAGACACTGCAAAGATAAAGTACG
GCGACTACGTTCTTTTTAGGCACAGCGACGTTGCAACACAGTTTATAGAGCAAACAATGATAAAACTGGT
GAAATGCGACGAAGGTGATGTGCTTACAGTAAATGAAAAAAAAGAGCTTTACTGTAACAATGCATTTATT
GGTCGAGCAAAAGATAAGGCTCTGAATGGAAAAAAGCTTGTCAACTTCGTCTGGAACGGTCCAGTTCCTC
CGGGAATGTTCTTACCGATGGGTGACCATAAAGATTCATACGATGGCAGGTACTACGGATTTTTGCCGAA
AAGCAAAGTTTTGAAAAAAGCTCACCCAGTATTTTGA
 Primer design