SecReT4
Protein ID: 118577384
T4SS name [ID]Tra_F [802]
Gene symbol-
Locus tagPpro_3782
StrainPelobacter propionicus DSM 2379
Repliconplasmid pPRO1 [GenBank: NC_008607] [Browse all T4SS(s) in this replicon]
Location [Strand]158157..158423 [-]
Producthypothetical protein
Component typeTraL_F
UniProt IDA0R7R3
KEGG IDppd:Ppro_3782
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 5.7e-07, Aligned region: 2..87
Protein Sequence: 88 a.a.     [Download]
>gi|118577384|ref|YP_899624.1| hypothetical protein Ppro_3782 [Pelobacter propionicus DSM 2379]
MKYRFPQYLSLPYRVLWFEMDDLMFFLMSIVIAQSVGGWAWLGLIIIPCMCTKVKRNYPRGFTKHMLYYI
GLINFKNYPDHFIKEFVE
 
Nucleotide Sequence: 267 bp     [Download]
>gi|118577231|ref|NC_008607.1|:c158423-158157 Pelobacter propionicus DSM 2379 plasmid pPRO1, complete sequence
ATGAAATATAGGTTTCCTCAATATTTATCACTGCCATATCGAGTACTCTGGTTTGAAATGGATGACTTGA
TGTTCTTCCTTATGTCCATAGTGATAGCTCAATCGGTAGGTGGTTGGGCATGGCTAGGGCTTATTATTAT
TCCGTGCATGTGCACTAAAGTAAAGCGGAACTATCCTAGGGGATTCACGAAACATATGCTTTACTATATC
GGTCTAATTAACTTCAAGAACTATCCTGACCATTTCATAAAGGAGTTTGTAGAATGA
 Primer design