SecReT4
Protein ID: 118578686
T4SS name [ID]Tra_F [556]
Gene symbol-
Locus tagPpro_0243
StrainPelobacter propionicus DSM 2379
Repliconchromosome [GenBank: NC_008609] [Browse all T4SS(s) in this replicon]
Location [Strand]239259..242858 [-]
Producthypothetical protein
Component typeTraG_F
UniProt IDA1AKK8
KEGG IDppd:Ppro_0243
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 1.5e-44, Aligned region: 28..484
Protein Sequence: 1199 a.a.     [Download]
>gi|118578686|ref|YP_899936.1| hypothetical protein Ppro_0243 [Pelobacter propionicus DSM 2379]
MWIRTVSRLGLALLLVLIPTLALALDMEFYVWGGHDAVVNAFGKLALIFGDNAYKSLYFVVITAGLFFGG
VTVFARLLGTGSGSVTTWIVPTLIGIMVYLALVVPKGTIHVYDPVYNKNQAVGGIPDGVVAVAGILNKIE
RGLVDIVTTAGDPLNYQSQAGGKGFLGLAQLTSIPLSAVDSNLDASLRRYVRDCVSYALMNPNANLTVDE
LRKTTTNFVSSLDKAINPAIWTVYYNAANPQGQTLTCTDAWTNIKSALTPASLTKNIYSVCTNLGYDVTD
AAAVTQCKTVLNNVNSGTGLGAASIDDFLRQAYISQRLEEIFRSGNATGATNYQFLLNASGAMKAANEWL
PILKAALTAIAVGLLPFLALFIPTPLIGKAVGIIAGFFIWLTAWGVTDAIVHQFAVDYANQAYETVRQNK
LGMDALYFFPDQTVKILGMFGTLRMSGMMLATVITGMLIRFGGHAMAMMAGSLGSQVQSAGSRAAHEVED
PAGRASAMQRNVTAMPTQAWSNEHSFQARQAQSLVGMSAKTTAASDMIRDFGMEFSSRMTADSELGRTIG
FGGAGRAMRENGLSSSYDLKSFDGRLGLDKLAAVRDVVGNSYGGDTNAFARMGVANDRSLANVFGSGDNY
AGFLTANMDKSVGQLQGEMGAYAAARSLGFRGSWREFNSLRSEISALGDYANADAVRTIADSYGISPAHL
MQMNSLFNQGKQASEVSGLSNQLGGPVAAGTEAGRVVATETGGKIQGIYAGGGYDNYQQLIGNDVSGRIA
RNQLVHAAADQMAGKIAPHLASDPEMYRDGHLTERGFAEMQKAMEGQNITFTTADGKSVVNVGMDGGVVN
SSEAGTVAKGDRAKSLDLQKQLRAAGFQSAAAHVARLSGQAFDYKADYDRNGNLASFSVDQGGRVQKFDL
GQSRTGTDVERLDRNVSTVDKGLRKTVGDFIKTGYENQSLNVTRKSGSYMIQAGGKQMIVNGDWYYAKND
KTGKMEVVGGSFSNGLDGNVLMYAKDKDGNLHYSQVQGKMDKSGNLIAGQRSEITEDQFVQSSQQGAAVV
STRSGGGITGSIRADGGVKADYSSRQTVGTSVSSVQNYAGSAASSDFVEGRSIDAGTVATTIAVGRGALH
EASGLIGDAATVAKPLTSSMEKSAAKREAETRMTEQAARTAETRVERDLQRTGRILQHQSKNSPLPKGGG
PQPYKGPRR
 
Nucleotide Sequence: 3600 bp     [Download]
>gi|118578449|ref|NC_008609.1|:c242858-239259 Pelobacter propionicus DSM 2379 chromosome, complete genome
ATGTGGATTCGGACCGTATCTAGGCTGGGACTGGCGCTTCTGCTGGTGCTGATCCCGACCTTGGCGCTGG
CCCTGGACATGGAGTTCTATGTCTGGGGAGGTCATGACGCCGTGGTGAACGCCTTCGGCAAACTGGCCCT
GATCTTCGGGGACAACGCCTACAAGTCGCTCTATTTTGTGGTCATCACCGCCGGCCTGTTCTTCGGCGGC
GTGACGGTGTTCGCCAGGCTCCTGGGCACCGGCAGCGGTTCGGTCACGACCTGGATCGTGCCGACTCTGA
TCGGCATCATGGTCTATCTGGCCCTGGTGGTTCCGAAGGGGACGATCCATGTTTATGATCCGGTCTACAA
CAAGAATCAGGCGGTGGGCGGGATTCCTGACGGTGTGGTGGCCGTGGCCGGTATTCTGAACAAGATCGAG
CGGGGGTTGGTGGATATCGTCACCACTGCCGGAGATCCCTTGAACTACCAGAGCCAGGCGGGCGGGAAGG
GTTTTCTGGGGCTGGCCCAGCTCACCAGTATCCCCCTGTCGGCGGTGGACAGCAATCTTGACGCTTCCCT
GCGGCGCTACGTCAGGGACTGCGTCTCCTATGCCCTGATGAACCCCAACGCCAACCTCACGGTGGATGAA
CTCCGGAAAACGACCACCAACTTTGTCAGCTCCCTGGACAAGGCGATCAACCCGGCCATCTGGACGGTCT
ACTACAATGCCGCCAACCCGCAGGGGCAGACGCTCACCTGTACCGACGCCTGGACCAACATCAAGTCGGC
ACTCACTCCGGCAAGTCTAACGAAAAACATCTACTCGGTCTGCACCAACCTCGGTTATGACGTGACCGAT
GCCGCCGCCGTGACCCAATGCAAGACGGTCCTGAACAACGTGAACAGCGGGACCGGACTCGGGGCGGCGA
GTATTGATGACTTCCTGAGGCAGGCCTACATCTCCCAGCGGCTGGAAGAGATCTTCCGCAGCGGCAATGC
TACCGGGGCAACCAACTACCAGTTCCTGTTGAACGCCTCCGGCGCCATGAAGGCGGCCAACGAATGGCTG
CCGATCCTGAAGGCGGCGCTTACGGCTATTGCTGTCGGGCTGTTGCCGTTCCTGGCGCTCTTCATTCCCA
CGCCGCTGATCGGCAAGGCGGTGGGGATCATCGCCGGTTTTTTCATCTGGCTCACCGCCTGGGGAGTGAC
CGACGCCATCGTGCACCAGTTCGCCGTGGATTACGCCAACCAGGCCTACGAGACGGTGCGCCAGAACAAG
CTTGGCATGGATGCGCTCTACTTCTTTCCTGACCAGACCGTGAAGATCCTCGGCATGTTCGGCACGCTCC
GCATGAGCGGCATGATGCTGGCCACGGTCATTACCGGGATGCTGATCCGGTTCGGCGGTCATGCCATGGC
GATGATGGCCGGCAGTCTGGGGAGCCAGGTGCAGTCGGCAGGGAGCCGGGCGGCCCATGAAGTAGAGGAC
CCGGCTGGCCGGGCGTCGGCCATGCAACGCAACGTGACGGCCATGCCGACCCAGGCCTGGAGCAACGAGC
ACAGTTTTCAGGCGAGACAGGCGCAGTCGCTGGTCGGCATGTCGGCCAAGACCACGGCGGCGAGCGATAT
GATCCGGGATTTCGGGATGGAGTTCTCCAGCCGGATGACTGCCGACAGTGAGTTGGGCCGGACAATCGGT
TTCGGAGGCGCCGGCAGGGCCATGCGGGAGAACGGCCTATCCTCGTCCTATGACCTGAAATCGTTCGATG
GCCGGTTGGGGCTGGACAAGTTGGCTGCGGTCCGGGATGTGGTCGGCAACAGCTATGGCGGTGATACCAA
TGCATTCGCCCGGATGGGGGTTGCCAATGACCGGAGCCTAGCCAATGTCTTTGGCTCCGGCGACAATTAT
GCCGGGTTCCTGACCGCCAACATGGACAAGAGTGTCGGTCAGCTTCAGGGGGAAATGGGCGCCTATGCCG
CTGCCAGGTCGCTCGGCTTCCGCGGCAGTTGGCGTGAGTTCAATTCGCTTCGCTCTGAGATATCTGCTCT
GGGCGATTACGCCAATGCCGATGCCGTGAGAACGATTGCCGACTCCTACGGGATCTCCCCGGCGCACCTG
ATGCAAATGAATTCGCTGTTCAATCAGGGGAAGCAGGCTTCGGAGGTTTCCGGACTCTCGAATCAGTTAG
GCGGGCCGGTTGCAGCAGGAACGGAAGCTGGCCGTGTCGTTGCGACCGAGACCGGCGGCAAGATCCAGGG
TATCTACGCAGGGGGAGGATACGACAACTACCAGCAGCTCATCGGTAATGACGTGTCGGGGCGGATCGCC
CGCAACCAACTGGTCCACGCTGCGGCTGACCAGATGGCCGGCAAGATTGCCCCGCACCTTGCCAGCGATC
CTGAAATGTACCGGGACGGTCACCTGACCGAACGGGGCTTTGCCGAGATGCAGAAGGCGATGGAGGGACA
GAACATCACCTTCACGACCGCCGACGGCAAGAGCGTCGTCAATGTCGGCATGGATGGCGGCGTCGTGAAC
TCCTCAGAAGCCGGTACCGTTGCAAAGGGGGACAGGGCCAAGTCGCTCGATCTGCAGAAGCAGCTCAGGG
CGGCCGGTTTCCAGAGTGCCGCCGCCCATGTAGCAAGGCTATCCGGACAGGCGTTCGACTACAAGGCGGA
TTACGACCGCAACGGCAATCTCGCATCATTCAGCGTCGATCAGGGCGGGCGGGTGCAGAAGTTCGATCTC
GGTCAGAGCCGGACCGGTACCGACGTGGAGCGGCTGGATCGGAATGTATCAACCGTCGACAAGGGATTAC
GCAAGACCGTCGGGGATTTCATCAAGACCGGCTACGAGAACCAGTCGCTGAACGTGACCCGGAAGTCAGG
TTCGTACATGATCCAGGCCGGCGGCAAGCAAATGATAGTCAATGGCGACTGGTACTACGCCAAGAACGAT
AAGACCGGCAAGATGGAGGTTGTGGGAGGCTCGTTCTCCAACGGCCTCGACGGCAATGTGCTGATGTACG
CCAAGGACAAGGACGGCAATCTGCACTATTCGCAGGTGCAGGGGAAAATGGATAAGAGCGGGAATCTTAT
TGCCGGGCAGCGCTCGGAGATTACCGAGGATCAATTTGTTCAGTCCTCACAGCAGGGAGCGGCGGTTGTC
AGTACCAGGTCGGGAGGTGGAATTACTGGGAGTATTCGTGCTGATGGCGGGGTGAAAGCGGATTATTCGT
CGAGACAAACTGTCGGTACATCTGTCAGCTCAGTACAGAATTATGCAGGTAGCGCTGCAAGCAGTGATTT
TGTTGAAGGGCGGTCAATTGACGCGGGAACTGTAGCAACAACGATAGCTGTTGGAAGGGGAGCGCTGCAC
GAAGCATCTGGTCTCATAGGAGATGCCGCTACTGTTGCCAAACCTTTGACTTCTTCAATGGAAAAGAGCG
CCGCTAAACGTGAAGCTGAGACACGCATGACTGAACAGGCCGCCAGGACGGCTGAAACTCGTGTTGAGAG
GGATTTGCAAAGAACTGGGAGAATCCTTCAGCATCAGAGCAAGAATTCTCCATTGCCAAAAGGTGGTGGC
CCACAGCCCTACAAAGGCCCGAGGAGGTAA
 Primer design