SecReT4
Protein ID: 118578689
T4SS name [ID]Tra_F [556]
Gene symbol-
Locus tagPpro_0246
StrainPelobacter propionicus DSM 2379
Repliconchromosome [GenBank: NC_008609] [Browse all T4SS(s) in this replicon]
Location [Strand]243846..244340 [-]
Producttype IV secretory protease
Component typeTraF_F
UniProt IDA1AKL1
KEGG IDppd:Ppro_0246
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 2.9e-15, Aligned region: 36..164
Protein Sequence: 164 a.a.     [Download]
>gi|118578689|ref|YP_899939.1| type IV secretory protease [Pelobacter propionicus DSM 2379]
MPKPLPPDFRNWRLWLAITCLLIAGTLLPGKFCVTLTPSLKHRVYWLTRNPDHVVRGDYVLFHDEELAAR
VGMKKSEDVLKLVGCDGGDQLTVDGEKKFYCNGEYLVRAKNFTLKGEPLRHFAFSGTIPEGAMFVVGEHK
DSYDSRYFGFVDKKRILAKAYPIF
 
Nucleotide Sequence: 495 bp     [Download]
>gi|118578449|ref|NC_008609.1|:c244340-243846 Pelobacter propionicus DSM 2379 chromosome, complete genome
ATGCCGAAACCGTTGCCCCCTGATTTCCGCAACTGGCGCCTCTGGTTGGCGATCACCTGCCTCCTTATTG
CAGGAACACTGCTCCCAGGCAAGTTCTGTGTCACCCTGACGCCTTCCCTCAAGCATCGGGTCTACTGGCT
CACCCGGAATCCGGACCATGTGGTTCGGGGGGATTACGTTCTGTTCCACGATGAGGAATTGGCGGCCAGG
GTCGGGATGAAGAAATCGGAAGACGTGCTGAAGCTCGTGGGGTGCGATGGGGGGGACCAACTCACCGTGG
ATGGGGAGAAGAAATTCTACTGCAACGGTGAGTACCTGGTCAGGGCCAAGAATTTTACCCTCAAGGGGGA
ACCGCTACGCCACTTCGCCTTCAGCGGCACGATCCCCGAGGGAGCCATGTTCGTCGTGGGAGAGCACAAG
GATAGCTACGATTCTCGGTATTTCGGCTTTGTGGACAAGAAACGCATCCTGGCGAAAGCCTATCCGATCT
TCTGA
 Primer design