SecReT4
Protein ID: 118578692
T4SS name [ID]Tra_F [556]
Gene symbol-
Locus tagPpro_0249
StrainPelobacter propionicus DSM 2379
Repliconchromosome [GenBank: NC_008609] [Browse all T4SS(s) in this replicon]
Location [Strand]245699..246721 [-]
ProductTraU family protein
Component typeTraU_F
UniProt IDA1AKL4
KEGG IDppd:Ppro_0249
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 3.9e-58, Aligned region: 32..335
Protein Sequence: 340 a.a.     [Download]
>gi|118578692|ref|YP_899942.1| TraU family protein [Pelobacter propionicus DSM 2379]
MNLSNSISIFTLAMLFLLAPLAYGGSGACRGKMLNPVTDICWQCMFPVKIGSATFGNGDEPAPGNITSPV
CVCPDSKGILVLGLSTAFWEHARLIETVREPFCFPALGTGMTNPKPGFYSGENRNAEYGDSNLAFQQAHY
FHFPAWSILKLFMDFPCSENKAFDLAYMTEVDPLWNDDSLSFIINPEALLFGNPVSQLACVADSVAATVT
QPVDPLFWCMGSWGSFYPLSGSMVENNPLNVNAGLAARMLFKLGRETLLFDTGINQCASGGVVTPILVKS
NYRLQMARPVRGNDCIPIGRPSLVWGAAKNPPFGTANNSPDNFLWSLTRRRVCCVGYALN
 
Nucleotide Sequence: 1023 bp     [Download]
>gi|118578449|ref|NC_008609.1|:c246721-245699 Pelobacter propionicus DSM 2379 chromosome, complete genome
ATGAACCTGAGCAATAGCATCTCGATCTTCACGCTGGCCATGCTTTTCCTGCTTGCGCCGCTTGCCTACG
GAGGCAGTGGCGCCTGCAGGGGGAAGATGCTCAACCCGGTGACCGATATCTGCTGGCAGTGCATGTTTCC
GGTGAAGATCGGCAGCGCTACCTTTGGCAATGGCGATGAACCGGCTCCCGGCAACATCACCTCGCCGGTC
TGCGTCTGCCCCGACAGCAAGGGGATCCTGGTTCTGGGATTGTCCACCGCGTTCTGGGAGCATGCCCGGC
TGATCGAAACGGTCAGGGAACCTTTCTGCTTTCCGGCACTGGGAACCGGCATGACAAATCCCAAGCCCGG
CTTTTATTCCGGAGAGAACCGGAACGCGGAGTACGGCGATTCCAACCTGGCATTCCAGCAGGCCCACTAC
TTCCATTTCCCGGCCTGGTCGATCCTGAAGCTGTTCATGGATTTTCCCTGCTCAGAAAACAAGGCCTTCG
ACTTGGCCTACATGACCGAAGTGGACCCACTGTGGAACGACGACAGCCTGTCGTTCATCATCAATCCCGA
GGCGCTTCTGTTCGGTAATCCGGTGTCACAGTTGGCGTGCGTGGCAGACAGCGTGGCGGCCACGGTGACC
CAGCCAGTCGATCCCCTGTTCTGGTGCATGGGGAGTTGGGGATCGTTCTACCCCCTGTCGGGGAGCATGG
TCGAGAACAATCCCCTCAACGTGAACGCCGGCCTGGCGGCACGGATGCTGTTCAAGCTCGGCCGCGAGAC
GCTCCTTTTTGATACCGGCATCAACCAGTGCGCCAGCGGCGGGGTCGTGACACCGATTCTGGTCAAGAGC
AACTACCGGCTTCAGATGGCGCGTCCGGTGCGGGGCAATGACTGCATCCCCATCGGCAGGCCGTCGCTGG
TCTGGGGGGCGGCGAAGAACCCTCCCTTTGGAACGGCCAACAACTCGCCGGACAATTTTCTCTGGTCGTT
GACACGAAGGAGGGTGTGTTGCGTCGGCTATGCGCTCAATTGA
 Primer design