SecReT4
Protein ID: 118578693
T4SS name [ID]Tra_F [556]
Gene symbol-
Locus tagPpro_0250
StrainPelobacter propionicus DSM 2379
Repliconchromosome [GenBank: NC_008609] [Browse all T4SS(s) in this replicon]
Location [Strand]247172..247828 [-]
Producthypothetical protein
Component typeTraW_F
UniProt IDA1AKL5
KEGG IDppd:Ppro_0250
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 218 a.a.     [Download]
>gi|118578693|ref|YP_899943.1| hypothetical protein Ppro_0250 [Pelobacter propionicus DSM 2379]
MIIRTGLAAIVLLVGVSSAHAKELGVFGMTYRIVERDALVEIEERAKQVDWHKVLDKRKVENFQGPPDRV
RLPRAKRNRSFQVDMTYTAEIDVPDGKGGILYPKGYTFNPLDYVTYPKTLVVIDGTDPEQVMWFATSECD
KRLDVTLLLSEGRLGAVSKRISRPLFYADRKIIERLKLKAVPSVVRQKGRVMEVTEVKLPAGHAKAAGAT
FHDRKRTP
 
Nucleotide Sequence: 657 bp     [Download]
>gi|118578449|ref|NC_008609.1|:c247828-247172 Pelobacter propionicus DSM 2379 chromosome, complete genome
ATGATCATTCGTACCGGACTGGCAGCGATTGTCCTTTTGGTGGGCGTTTCATCGGCTCATGCCAAAGAGC
TTGGCGTCTTCGGCATGACGTACCGGATCGTGGAGCGGGATGCCCTGGTCGAGATAGAGGAGCGGGCCAA
ACAGGTGGACTGGCACAAGGTGCTGGACAAACGGAAGGTCGAGAACTTCCAGGGACCGCCGGACAGGGTG
CGCCTGCCGCGTGCGAAGCGGAACCGGAGCTTCCAGGTTGACATGACCTATACCGCCGAGATCGATGTCC
CCGACGGCAAGGGAGGAATCCTCTATCCCAAGGGGTATACCTTCAACCCCCTCGACTATGTGACCTACCC
GAAAACGCTGGTGGTCATCGACGGTACCGACCCGGAGCAGGTGATGTGGTTTGCCACATCCGAGTGCGAC
AAACGGCTCGATGTGACGCTCCTCCTCTCCGAAGGGAGACTCGGGGCCGTGTCAAAGAGGATCAGTCGTC
CCTTGTTCTATGCCGACAGGAAGATCATTGAACGCCTCAAGCTGAAGGCTGTGCCGTCGGTAGTCAGGCA
GAAGGGGCGGGTCATGGAAGTAACTGAAGTAAAGCTGCCGGCAGGTCATGCCAAGGCTGCCGGTGCAACA
TTTCATGACAGGAAGAGAACGCCATGA
 Primer design