SecReT4
Protein ID: 118578694
T4SS name [ID]Tra_F [556]
Gene symbol-
Locus tagPpro_0251
StrainPelobacter propionicus DSM 2379
Repliconchromosome [GenBank: NC_008609] [Browse all T4SS(s) in this replicon]
Location [Strand]247825..249666 [-]
Producthypothetical protein
Component typeTraN_F
UniProt IDA1AKL6
KEGG IDppd:Ppro_0251
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 6.9e-21, Aligned region: 268..426
TraN [PF06986], Evalue: 6.9e-21, Aligned region: 480..565
Protein Sequence: 613 a.a.     [Download]
>gi|118578694|ref|YP_899944.1| hypothetical protein Ppro_0251 [Pelobacter propionicus DSM 2379]
MLVRVVCSLCYVTLLLSLSGAHQTALALVSCQDRISANTPHRYIDALALFTEYNGTTYAIAKSAVSGSQS
LPDGYFNFEANISREYLTTGTDTASLKRMLALGRFGEARPVRIDSRQTLDFVLKRFGAYLGSADSPQSTY
IDAWKEFGLTGFTALAGTGLPFTNWGTGTPYGGQDPQAVVMGRDGIWTSGLDGVRSSQIVQFPGKLDCSY
SYIDPTTLPPVSPPATETFGTIICAQDLNNNGYAADPGEVATCVVTPQGQYCPVGSVECNLVNSAYVCPL
GSQYVCMEYQGVMRCSSNSCFDQTTTEEEADDIDESMLRDDGDRDALGQCLGQLYVFNGKASRCRPPGMK
VGMINDCCESDQVAAEDTGNSILSATQGIQMAYEIGQVAYYGNALLTGAAQISAITTTATGTVASMTVVT
AAGTTTTLSGAVATGAYATMASGATGASAIGAGLQAYATALLNPATIAVAVAVMVVMKLLMGGGCDQGDI
QTAMQNAAKDCHYVGSYCQKKWPLVGCVQKAKSYCCFNSKMARIIHEQGRPQLLPFQPNGAWGSAKHPNC
RGFTPEEFQALDFSRIDLSEYFADVQKDLATKIQGSQQTIMQNIQNRYQAAPK
 
Nucleotide Sequence: 1842 bp     [Download]
>gi|118578449|ref|NC_008609.1|:c249666-247825 Pelobacter propionicus DSM 2379 chromosome, complete genome
ATGCTCGTCCGTGTCGTCTGTTCACTATGTTATGTCACGCTTCTGCTCTCGCTCTCGGGTGCCCACCAGA
CGGCGCTGGCTCTTGTCAGTTGCCAGGACAGGATTTCGGCAAATACGCCGCATCGTTACATCGATGCTCT
GGCACTGTTCACCGAGTACAACGGCACAACCTATGCCATCGCCAAATCGGCCGTGAGCGGCAGCCAGTCG
CTGCCGGACGGCTATTTCAATTTCGAGGCGAACATCAGCCGGGAATACCTGACGACCGGAACCGATACGG
CATCACTCAAACGGATGCTCGCCCTTGGTCGATTCGGTGAGGCCAGGCCGGTCAGGATCGACAGTCGGCA
GACGCTGGATTTCGTTCTCAAACGTTTCGGAGCCTATCTCGGTTCGGCGGATTCCCCACAAAGCACCTAC
ATCGACGCTTGGAAGGAGTTCGGCCTGACCGGTTTTACCGCCCTTGCCGGTACGGGACTTCCTTTCACCA
ACTGGGGCACGGGAACACCCTATGGGGGACAGGATCCGCAAGCGGTAGTCATGGGACGTGACGGGATCTG
GACCAGCGGCCTGGATGGGGTCAGGTCGTCCCAGATCGTACAGTTTCCCGGCAAACTGGACTGTTCGTAT
TCCTACATCGATCCGACGACGCTACCGCCGGTATCGCCACCCGCTACCGAGACGTTCGGCACCATCATCT
GCGCCCAGGACCTGAACAACAATGGCTATGCCGCCGATCCGGGCGAGGTGGCCACCTGTGTTGTGACGCC
ACAGGGGCAGTACTGTCCGGTGGGTTCCGTCGAGTGCAATCTGGTCAACTCGGCATACGTCTGCCCGCTG
GGCTCCCAGTACGTTTGCATGGAATACCAGGGTGTGATGCGTTGCTCGTCGAATTCCTGCTTCGATCAAA
CAACGACTGAGGAGGAGGCAGATGACATCGATGAATCGATGCTGCGGGACGACGGGGATCGGGATGCCCT
GGGGCAGTGTCTCGGGCAGTTGTACGTCTTCAACGGCAAGGCGTCCCGCTGTCGCCCGCCGGGGATGAAG
GTGGGGATGATCAACGATTGCTGCGAGAGCGACCAGGTGGCTGCGGAAGACACCGGTAACAGTATCCTGT
CGGCGACGCAGGGGATTCAGATGGCATACGAGATCGGTCAGGTCGCCTACTACGGCAATGCCCTGCTGAC
CGGCGCCGCCCAGATTTCGGCCATCACCACGACCGCAACCGGCACGGTCGCGTCCATGACCGTGGTCACC
GCGGCCGGAACCACCACGACCCTGTCGGGAGCGGTGGCAACCGGAGCCTACGCCACCATGGCCAGCGGCG
CTACGGGAGCCTCGGCCATCGGCGCAGGCCTGCAGGCCTATGCCACGGCGCTGTTAAATCCGGCAACCAT
TGCCGTTGCCGTGGCTGTCATGGTGGTGATGAAGCTGTTGATGGGGGGAGGCTGTGATCAGGGAGATATT
CAGACGGCGATGCAGAATGCCGCCAAGGATTGCCACTATGTGGGCAGTTACTGTCAGAAGAAATGGCCGC
TGGTGGGGTGTGTCCAGAAGGCCAAGAGCTACTGCTGTTTCAACTCGAAAATGGCAAGGATTATCCATGA
GCAGGGAAGACCACAACTCCTGCCGTTCCAGCCGAACGGCGCCTGGGGGAGCGCGAAACACCCGAACTGC
AGAGGATTCACGCCCGAAGAATTTCAGGCACTGGATTTCTCGCGGATCGATCTTTCTGAATATTTCGCGG
ACGTGCAGAAGGATCTGGCCACCAAGATCCAGGGATCGCAGCAAACGATCATGCAGAACATCCAGAACAG
ATATCAGGCGGCGCCAAAATGA
 Primer design