SecReT4
Protein ID: 118578696
T4SS name [ID]Tra_F [556]
Gene symbol-
Locus tagPpro_0253
StrainPelobacter propionicus DSM 2379
Repliconchromosome [GenBank: NC_008609] [Browse all T4SS(s) in this replicon]
Location [Strand]251608..254055 [-]
Productsex pilus assembly protein
Component typeTraC_F
UniProt IDA1AKL8
KEGG IDppd:Ppro_0253
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 7.1e-52, Aligned region: 442..732
TraC_F_IV [PF11130], Evalue: 2.2e-49, Aligned region: 25..244
DUF87 [PF01935], Evalue: 3.2e-07, Aligned region: 433..607
Protein Sequence: 815 a.a.     [Download]
>gi|118578696|ref|YP_899946.1| sex pilus assembly protein [Pelobacter propionicus DSM 2379]
MGVVSALLGSGGGVTRKELLSLVERDRFSEYFPWIAHDPRKQIYLNTDNTFGMMWECAPLAFACETTIRT
LEGLFRVNLPEGSIMQFILLADPFVKRMVDTYTAMKTRDSKLVRSVSDNVSRFFQEGAEGLDCLNGIPVR
NFRMFFCVKFPVKSSPHVNLEEVFGTIQEVLKGAGLSPVAVEPGRLLDWLRRMLNDDPSANASHYDERNV
IRKQVLLGTKVEKRFSSLKFGSRHFRCVTPKSFPPDGDPIQTNQLFGGIMGMATDADQIRTPFFFTLNIV
LRNQKNRLHTKCNLVLQQQGVGSFAPSLARKKDEYLWAVDELERGTRFYRIIPIMWVYGSDEWLVNESVT
RAKRVWEGQGYVMQEDKGILPILFISSLPFGLYDHGSNIDTLDRDHIMPVDSIAVTLPIQGDFSGLGKPV
MLFAGRKGNLFGLDIFNKGVNNHNVVVCASSGAGKSFFTNYLVYNYFAMNSRIRIVDIGGSYKKMTKLFG
ARYLDFSEDSQVCLNPFTTIIDPEYDIPVIAPIVAQMVYSTGKTFPSETEMTLIKQAVRWAWQQEGNDAG
IDTVYEYLANFDRYSSEGTEIKEAASRLAFNLADFRSDGSFGRFFNGKSSLDISNDEFVVLELEHLKSRK
ELFRVVTLQVINAVTQDLYLSDKSDQRLIVFDEAWQFLGESSTLKEVIEEGYRRARKYFGSFTIITQSVL
DMKLFGGVGDVIRNNSAFKFFLESSDFEKALDEKLLDYDDFTMRILKSTKSNKPKYSEIFMDTPFGVGVG
RLVVDPFSYYVFTSDASEIAQIEAMVDGGMSYEDAIREMVKKYRS
 
Nucleotide Sequence: 2448 bp     [Download]
>gi|118578449|ref|NC_008609.1|:c254055-251608 Pelobacter propionicus DSM 2379 chromosome, complete genome
ATGGGCGTTGTTTCAGCGTTACTTGGAAGCGGAGGAGGCGTCACCAGAAAGGAACTGCTCAGCCTTGTCG
AGCGGGACAGATTCTCCGAGTATTTTCCCTGGATCGCCCATGATCCAAGGAAACAGATCTACCTCAACAC
CGACAATACCTTCGGGATGATGTGGGAGTGCGCTCCCCTGGCATTTGCGTGTGAGACTACCATCAGGACC
CTTGAAGGTCTATTTCGCGTCAATCTGCCTGAAGGCTCGATCATGCAGTTCATTCTGCTGGCCGATCCCT
TCGTGAAAAGGATGGTTGACACCTACACCGCCATGAAGACGCGAGACAGCAAACTGGTGAGGAGTGTCTC
TGATAACGTGTCACGCTTCTTTCAGGAAGGAGCAGAAGGGCTTGACTGTCTGAACGGCATCCCGGTTCGA
AACTTCCGGATGTTTTTCTGCGTCAAGTTCCCGGTCAAGAGCAGCCCGCACGTCAATCTCGAAGAGGTGT
TCGGCACCATCCAGGAAGTATTGAAAGGCGCCGGCCTCTCGCCGGTCGCGGTCGAGCCTGGGCGGCTTCT
GGACTGGCTGCGGCGCATGCTGAACGACGACCCATCCGCCAATGCCAGTCACTATGACGAACGCAATGTC
ATCCGCAAGCAGGTACTGCTCGGGACAAAGGTGGAGAAGAGGTTCTCGTCACTCAAATTCGGCTCTCGCC
ACTTCCGTTGTGTCACTCCCAAATCCTTTCCCCCTGATGGCGACCCGATCCAGACCAACCAGCTTTTCGG
AGGGATCATGGGCATGGCGACCGACGCCGACCAGATTCGGACGCCATTTTTCTTCACGCTGAACATAGTC
CTGCGCAACCAGAAGAACAGACTCCACACCAAATGCAATCTGGTCCTGCAGCAGCAGGGGGTCGGCAGCT
TCGCCCCGTCGCTGGCCAGGAAGAAAGACGAATATCTCTGGGCGGTGGACGAACTGGAGAGGGGCACCAG
GTTTTACCGGATCATCCCGATCATGTGGGTCTACGGCAGCGACGAGTGGCTGGTGAACGAGTCCGTAACC
CGGGCCAAACGGGTCTGGGAGGGGCAAGGGTATGTCATGCAGGAAGACAAAGGGATTCTCCCCATCCTGT
TCATCTCATCTCTTCCATTCGGGCTCTACGACCACGGCAGCAATATCGACACCCTCGACCGGGACCACAT
CATGCCGGTGGACAGCATCGCCGTCACCTTGCCGATCCAGGGTGATTTCTCGGGTCTCGGCAAGCCGGTC
ATGCTCTTTGCCGGGCGAAAAGGGAACCTGTTCGGTCTCGATATCTTCAACAAGGGGGTCAATAACCACA
ACGTCGTGGTCTGTGCTTCCAGCGGAGCGGGGAAAAGTTTCTTCACCAACTATCTGGTCTACAACTACTT
CGCCATGAACTCCAGGATCAGGATCGTGGATATCGGCGGCTCCTACAAGAAGATGACCAAGCTGTTCGGA
GCCCGTTATCTGGATTTCAGCGAGGATTCCCAGGTCTGTCTGAATCCCTTTACCACCATCATCGATCCCG
AGTATGACATCCCGGTCATCGCCCCCATCGTCGCTCAGATGGTCTATTCCACCGGGAAGACCTTTCCCAG
CGAAACCGAGATGACCCTCATCAAGCAGGCCGTGCGCTGGGCATGGCAGCAGGAGGGGAATGACGCCGGC
ATCGATACCGTCTACGAATACCTGGCCAATTTCGACCGCTACTCCTCAGAAGGAACGGAAATCAAAGAGG
CTGCCTCCCGGTTGGCCTTCAACCTGGCCGATTTCAGGAGCGACGGTTCCTTTGGCCGTTTCTTCAACGG
TAAAAGCAGCCTCGACATCTCCAACGACGAGTTCGTGGTTCTCGAACTGGAGCATCTCAAGTCCAGAAAA
GAGCTGTTCCGGGTGGTCACCCTCCAGGTGATCAACGCCGTTACCCAGGATCTCTACCTTTCCGACAAGT
CGGACCAGCGTCTGATCGTCTTTGACGAGGCGTGGCAATTCCTCGGGGAGAGTTCGACCCTGAAGGAGGT
CATCGAGGAAGGGTACCGCCGGGCCCGGAAGTACTTCGGCAGCTTCACCATCATCACCCAGTCGGTGCTC
GACATGAAACTCTTCGGCGGAGTCGGAGACGTGATCAGAAACAATTCCGCCTTCAAGTTCTTCCTGGAAT
CGTCGGACTTCGAAAAAGCCCTGGACGAGAAGCTTTTGGACTACGACGACTTCACCATGCGGATTCTCAA
GTCCACCAAGAGCAACAAGCCCAAGTATTCGGAGATTTTTATGGATACCCCGTTCGGGGTGGGTGTCGGC
AGGCTGGTGGTTGATCCTTTTTCCTACTACGTGTTCACGTCCGATGCGAGCGAGATCGCGCAGATCGAAG
CAATGGTGGATGGCGGGATGAGTTACGAGGATGCGATCCGTGAGATGGTCAAGAAGTATCGCAGCTAG
 Primer design