SecReT4
Protein ID: 118578697
T4SS name [ID]Tra_F [556]
Gene symbol-
Locus tagPpro_0254
StrainPelobacter propionicus DSM 2379
Repliconchromosome [GenBank: NC_008609] [Browse all T4SS(s) in this replicon]
Location [Strand]254058..254516 [-]
Producthypothetical protein
Component typeTraV_F
UniProt IDA1AKL9
KEGG IDppd:Ppro_0254
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 4.8e-17, Aligned region: 11..140
Protein Sequence: 152 a.a.     [Download]
>gi|118578697|ref|YP_899947.1| hypothetical protein Ppro_0254 [Pelobacter propionicus DSM 2379]
MGGCTLLNPYESSFSCPETSNGKCVSVQTAYKESAVGPGNPNDPVPEHKEDDCGTDNAAPGSCTDIKNTL
SLNPQARENAPYSRYQSALFEKFSGLLKEPVTPIVAPPKTMRVLLLPYTGQDNEFYMLRYVYFFVDEPRW
LLDGSVMSGEEE
 
Nucleotide Sequence: 459 bp     [Download]
>gi|118578449|ref|NC_008609.1|:c254516-254058 Pelobacter propionicus DSM 2379 chromosome, complete genome
ATGGGCGGTTGTACCCTGCTCAACCCCTATGAAAGCAGTTTCAGTTGCCCTGAAACCAGCAATGGCAAGT
GTGTTTCGGTGCAAACCGCCTACAAGGAGTCGGCAGTTGGCCCTGGCAACCCAAATGATCCGGTTCCAGA
GCATAAAGAAGACGATTGCGGTACCGACAACGCTGCTCCCGGGAGCTGTACCGATATCAAGAATACTCTG
TCGCTGAACCCTCAAGCCAGGGAGAACGCCCCCTATTCTCGATACCAGTCGGCGCTGTTCGAAAAATTCA
GTGGATTACTGAAAGAACCGGTCACACCGATCGTTGCCCCGCCAAAAACGATGCGTGTTCTGCTTCTGCC
GTACACCGGGCAGGACAACGAATTCTATATGCTGCGCTACGTGTATTTTTTCGTGGATGAACCGCGCTGG
CTGCTGGATGGCTCCGTCATGTCGGGCGAGGAGGAGTAG
 Primer design