SecReT4
Protein ID: 118578698
T4SS name [ID]Tra_F [556]
Gene symbol-
Locus tagPpro_0255
StrainPelobacter propionicus DSM 2379
Repliconchromosome [GenBank: NC_008609] [Browse all T4SS(s) in this replicon]
Location [Strand]254549..255805 [-]
ProductTraB pilus assembly family protein
Component typeTraB_F
UniProt IDA1AKM0
KEGG IDppd:Ppro_0255
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 2.2e-39, Aligned region: 207..407
Protein Sequence: 418 a.a.     [Download]
>gi|118578698|ref|YP_899948.1| TraB pilus assembly family protein [Pelobacter propionicus DSM 2379]
MMKDKLLAYWNGLGGGKRKNLVWCLTGSILVFVFAVGYFAMSGGKDPAISISPKQVPLNIEPKLLEKSQF
LESQKEIAKRDDKVAELQKKLDEITREKRGEVPSAPAAPDSLPSVTGQPQGQTQKAGSGRAALSKQSLPP
PPPVPQGSTILLPPPPAASQGIQAGQMPDPAETELGNISIVSSPVSSKSAKHDAEDKKKDAGTVSVYLPP
SFMEATLLSGLDAPTTSEAKGNPVPVLLRVKTPAVLPNSVKANLKGCFVIADGKGNLATERAELLLVSLS
CLDRKGQAVVDQKVKGFVVDADGKIGLRGRVVAKMGSMIARSMLAGFFGGAGDAIKASATTMSVSPLGTT
QTVDPKDIAMAGAGTGLSSGFKEIQKFYMELAKQTMPVIEVGATKPVTLVISEGINLQIKRIAKGGSE
 
Nucleotide Sequence: 1257 bp     [Download]
>gi|118578449|ref|NC_008609.1|:c255805-254549 Pelobacter propionicus DSM 2379 chromosome, complete genome
ATGATGAAAGATAAGCTTCTGGCGTACTGGAACGGACTTGGTGGCGGCAAACGTAAAAATCTCGTCTGGT
GCCTTACCGGCAGCATTCTCGTTTTTGTATTCGCTGTTGGCTACTTTGCCATGAGCGGGGGGAAAGATCC
CGCCATATCAATAAGCCCGAAGCAGGTCCCCCTGAACATCGAACCGAAGCTCCTGGAAAAATCCCAGTTT
CTTGAGAGCCAGAAAGAGATAGCCAAACGGGACGACAAAGTTGCCGAACTCCAGAAAAAACTCGATGAAA
TTACCCGCGAAAAAAGGGGGGAAGTGCCGTCTGCTCCGGCAGCGCCTGATTCTCTTCCCTCCGTCACCGG
ACAACCGCAGGGCCAGACTCAGAAGGCCGGTTCCGGCAGAGCGGCACTATCAAAGCAGTCGCTGCCGCCT
CCTCCACCCGTGCCACAAGGCAGTACAATTTTGCTGCCTCCACCACCTGCTGCGTCGCAGGGTATTCAGG
CAGGGCAGATGCCGGATCCAGCCGAGACGGAACTTGGCAATATCTCCATAGTCTCGTCTCCCGTTTCCAG
TAAATCCGCCAAGCATGACGCGGAAGATAAAAAAAAAGACGCCGGAACGGTCTCCGTCTATCTGCCCCCT
TCCTTTATGGAGGCGACCCTGTTGAGTGGCTTGGACGCCCCCACCACTTCGGAAGCCAAAGGTAATCCGG
TGCCGGTCCTGCTCAGGGTCAAGACTCCGGCGGTCCTGCCCAACAGCGTCAAGGCCAACCTCAAGGGATG
CTTCGTCATCGCTGACGGCAAGGGGAACCTGGCCACCGAACGAGCCGAACTGCTGCTGGTCTCCCTGTCA
TGCCTCGACCGCAAGGGGCAGGCGGTGGTTGACCAGAAGGTCAAAGGGTTCGTCGTGGACGCAGACGGCA
AGATCGGCCTGCGCGGTCGGGTCGTGGCCAAAATGGGCTCCATGATTGCCAGAAGCATGTTGGCCGGTTT
TTTCGGCGGCGCCGGTGATGCCATCAAGGCGTCGGCCACCACCATGTCGGTAAGCCCACTGGGGACCACC
CAGACGGTAGATCCAAAGGATATCGCCATGGCCGGTGCCGGAACTGGCCTGTCCAGCGGCTTCAAGGAGA
TCCAGAAATTCTACATGGAACTGGCCAAACAGACCATGCCGGTCATCGAGGTAGGAGCCACCAAGCCGGT
GACGCTGGTCATCAGCGAGGGGATCAACCTGCAAATCAAAAGGATCGCCAAGGGAGGCTCGGAGTGA
 Primer design