SecReT4
Protein ID: 118578699
T4SS name [ID]Tra_F [556]
Gene symbol-
Locus tagPpro_0256
StrainPelobacter propionicus DSM 2379
Repliconchromosome [GenBank: NC_008609] [Browse all T4SS(s) in this replicon]
Location [Strand]255792..256739 [-]
Producthypothetical protein
Component typeTraK_F
UniProt IDA1AKM1
KEGG IDppd:Ppro_0256
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 5.3e-56, Aligned region: 5..261
Protein Sequence: 315 a.a.     [Download]
>gi|118578699|ref|YP_899949.1| hypothetical protein Ppro_0256 [Pelobacter propionicus DSM 2379]
MRGMFALLVALLAPAVAHSADHVGIEKQKTTVDTSNEKPAEGEFPTVVLPEAATAIRLSSSDINRIACPS
EISEVLTSTEKGITVKITGKDAFVKFKVVKKGDKFSYSSTPTEFYVVCGDKVFSMVAFPQRVPSQTIRLS
SGLEKKIRENLSLYSGLPFEKKVLKAIREVYTENIPDSYTINKQEKRFITFKEILLTLKRTVDIEGEGLR
IKEYEASLRGATPEFKMNEKMFLRAALAENPIAISLERHILRTGDSSRIFVVEQRAERQGPHKLAGDLPM
LDQPQQGQPVAKPGLQKDPPVNRTEQDGQETDDER
 
Nucleotide Sequence: 948 bp     [Download]
>gi|118578449|ref|NC_008609.1|:c256739-255792 Pelobacter propionicus DSM 2379 chromosome, complete genome
ATGCGCGGAATGTTTGCATTACTGGTCGCATTGCTGGCACCGGCAGTGGCCCATTCTGCTGACCACGTGG
GAATCGAGAAACAGAAGACCACCGTTGACACGTCTAACGAGAAACCGGCTGAAGGTGAATTCCCGACGGT
GGTCTTACCTGAGGCAGCAACCGCCATTCGTCTGTCGAGTTCAGACATCAACCGCATTGCCTGCCCCAGC
GAGATCAGTGAAGTGCTCACTTCAACCGAGAAGGGGATCACGGTCAAGATCACCGGCAAGGATGCATTTG
TGAAGTTCAAGGTGGTGAAGAAAGGGGACAAGTTTTCCTACTCTTCGACACCGACTGAGTTTTATGTCGT
CTGCGGTGACAAAGTCTTCAGCATGGTTGCCTTTCCCCAGAGGGTTCCTTCCCAGACGATCCGGCTTTCT
TCCGGCCTGGAGAAGAAAATCAGGGAGAACCTCTCCCTGTATTCCGGTCTGCCCTTTGAGAAGAAAGTTC
TCAAGGCCATCAGGGAGGTCTACACCGAGAATATCCCCGACTCTTACACCATCAACAAGCAGGAGAAGCG
GTTCATTACGTTCAAGGAAATCCTGCTCACCCTCAAACGGACAGTGGATATCGAAGGGGAAGGCCTTCGA
ATCAAGGAGTACGAGGCTTCGCTACGCGGTGCAACCCCCGAGTTCAAGATGAACGAAAAGATGTTTCTAA
GAGCAGCTCTGGCGGAAAACCCGATAGCGATTTCCCTGGAACGCCACATTTTACGGACAGGCGACTCATC
GCGAATTTTTGTGGTGGAGCAGCGCGCCGAACGACAGGGCCCCCATAAACTGGCCGGCGACCTGCCGATG
TTGGACCAGCCGCAACAGGGGCAGCCCGTTGCCAAACCCGGTCTTCAGAAAGATCCCCCCGTAAACCGCA
CCGAACAGGATGGCCAGGAGACTGATGATGAAAGATAA
 Primer design