SecReT4
Protein ID: 118578700
T4SS name [ID]Tra_F [556]
Gene symbol-
Locus tagPpro_0257
StrainPelobacter propionicus DSM 2379
Repliconchromosome [GenBank: NC_008609] [Browse all T4SS(s) in this replicon]
Location [Strand]256739..257317 [-]
Productputative sex pilus assembly and synthesis protein
Component typeTraE_F
UniProt IDA1AKM2
KEGG IDppd:Ppro_0257
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 4.5e-29, Aligned region: 1..182
Protein Sequence: 192 a.a.     [Download]
>gi|118578700|ref|YP_899950.1| putative sex pilus assembly and synthesis protein [Pelobacter propionicus DSM 2379]
MNLDLFLQKSSNIFAENRLLKFVVVVLGIAVAINTAGLFIALNSQRVILVPPAINSKISISGDKASEEYL
KEFTRYILNLALTYNPVNARSQFSELLAVYDPAEFQATRKELYELADKIENTQASSAFYIHSIINDTEKR
RLEVTGTKKTYMVDQKAEDTQKVYLIEYRFENGKFILVRLYEKPAQGDNGGA
 
Nucleotide Sequence: 579 bp     [Download]
>gi|118578449|ref|NC_008609.1|:c257317-256739 Pelobacter propionicus DSM 2379 chromosome, complete genome
GTGAACCTCGATCTATTCCTGCAGAAAAGTTCCAACATCTTTGCCGAGAACCGGTTACTCAAGTTCGTGG
TGGTGGTCCTCGGCATCGCCGTAGCCATCAATACCGCCGGCTTGTTCATAGCCTTGAACAGCCAACGTGT
CATCCTCGTTCCTCCGGCCATCAACTCGAAAATCTCGATTTCCGGTGACAAGGCCTCGGAGGAATACCTC
AAGGAGTTCACACGCTACATCCTGAATCTGGCCCTGACCTACAACCCAGTCAATGCCCGGTCACAGTTCA
GTGAACTGCTGGCCGTCTATGACCCGGCCGAATTCCAGGCAACCAGGAAAGAGCTGTACGAATTGGCTGA
CAAAATCGAAAACACCCAGGCCTCCAGCGCCTTTTATATCCATTCGATCATCAACGACACCGAGAAGAGG
CGGCTCGAAGTTACTGGCACCAAGAAGACCTACATGGTGGATCAGAAGGCCGAAGATACCCAGAAGGTCT
ACCTCATCGAATACCGCTTTGAGAACGGGAAATTCATCCTGGTCCGCCTCTACGAGAAACCGGCTCAGGG
TGACAACGGGGGGGCATGA
 Primer design