SecReT4
Protein ID: 118578701
T4SS name [ID]Tra_F [556]
Gene symbol-
Locus tagPpro_0258
StrainPelobacter propionicus DSM 2379
Repliconchromosome [GenBank: NC_008609] [Browse all T4SS(s) in this replicon]
Location [Strand]257340..257606 [-]
Producthypothetical protein
Component typeTraL_F
UniProt IDA1AKM3
KEGG IDppd:Ppro_0258
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 7.8e-07, Aligned region: 4..70
Protein Sequence: 88 a.a.     [Download]
>gi|118578701|ref|YP_899951.1| hypothetical protein Ppro_0258 [Pelobacter propionicus DSM 2379]
MTRKFPQYLTKPFQVLWFEPDDLAVMSASFIFAQQFGGWLWLTMIIIPWAYGRFKRQYPRGFLRHVLYFI
GLAPMKGYPQFFERDFLE
 
Nucleotide Sequence: 267 bp     [Download]
>gi|118578449|ref|NC_008609.1|:c257606-257340 Pelobacter propionicus DSM 2379 chromosome, complete genome
TTGACCCGCAAGTTTCCCCAATATCTGACCAAGCCGTTTCAGGTTCTCTGGTTCGAACCTGACGACTTGG
CGGTCATGTCGGCCAGTTTCATCTTCGCCCAGCAGTTCGGAGGGTGGCTGTGGCTGACCATGATCATTAT
CCCGTGGGCATATGGCCGCTTCAAACGACAGTACCCACGAGGTTTCCTGCGGCATGTGCTCTACTTTATT
GGCTTGGCGCCGATGAAAGGTTACCCACAGTTTTTCGAAAGAGATTTTCTGGAATGA
 Primer design