SecReT4
Protein ID: 118601948
T4SS name [ID]Tra_F [589]
Gene symbol-
Locus tagP91278ORF_050
StrainPhotobacterium damselae subsp. piscicida plasmid pP91278 (NC_008613)
Repliconplasmid pP91278 [GenBank: NC_008613] [Browse all T4SS(s) in this replicon]
Location [Strand]35684..35965 [+]
Producthypothetical protein
Component typeTraL_F
UniProt IDA0PB00
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 3.4e-15, Aligned region: 4..80
Protein Sequence: 93 a.a.     [Download]
>gi|118601948|ref|YP_908648.1| hypothetical protein P91278ORF_050 [Photobacterium damselae subsp. piscicida]
MKPVKIPRRVDEPPHLLLWSADELAPMLLGLTIGVIIGKALICFLGGLLVTNLYRRFRDNHPDGYLLHMI
YWAGFIMTKAKSLKNPFVRRYLP
 
Nucleotide Sequence: 282 bp     [Download]
>gi|118601898|ref|NC_008613.1|:35684-35965 Photobacterium damselae subsp. piscicida plasmid pP91278, complete sequence
ATGAAGCCTGTAAAGATACCGCGCCGGGTCGATGAGCCCCCGCATCTGCTGTTGTGGAGCGCAGATGAGT
TGGCCCCGATGCTTTTGGGGCTAACGATAGGGGTCATCATCGGTAAGGCCCTGATCTGCTTTCTGGGGGG
GTTACTTGTAACCAACCTTTATCGCCGATTCAGGGATAACCATCCGGATGGATACCTGCTCCACATGATC
TACTGGGCCGGGTTCATCATGACCAAGGCCAAATCTCTCAAGAATCCGTTTGTCCGGAGGTATTTGCCTT
GA
 Primer design