SecReT4
Protein ID: 118602017
T4SS name [ID]Tra_F [589]
Gene symbol-
Locus tagP91278ORF_119
StrainPhotobacterium damselae subsp. piscicida plasmid pP91278 (NC_008613)
Repliconplasmid pP91278 [GenBank: NC_008613] [Browse all T4SS(s) in this replicon]
Location [Strand]100711..101751 [+]
Producthypothetical protein
Component typeTraF_F
UniProt IDA0PB69
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 4.1e-68, Aligned region: 47..276
Protein Sequence: 346 a.a.     [Download]
>gi|118602017|ref|YP_908717.1| hypothetical protein P91278ORF_119 [Photobacterium damselae subsp. piscicida]
MGKYVRETMKKSPLNLLLLAALTLGASHQAWAQDGTRPGFYERKEEGWFWYKEEPKEPEKKPEKPKPKPV
AEAKPTQPKPAAPLPSGPEMFSAEWFRENLPKYKDLAWNNPTVENVRTFLYLQRFAIDRSEQFSDATELA
VVGDPFLDEITRRPAATFASQQVDRDAGNAKNMLLKSVAERVGIFFFYKSDDDYSDLQAPLIKMLEQGEG
FSIIPVSMDGKPLPSGLFPHYKTDEGHAKQLGIVTFPAVYLASPDGQFAPIGQGPMSLPELNHRILVAAK
RNGWVTDEEFNRTRPVLNLENNIAERLASPELGSDLKQLSQASGDKDNFVPPEQLMKYIRDKLQEN
 
Nucleotide Sequence: 1041 bp     [Download]
>gi|118601898|ref|NC_008613.1|:100711-101751 Photobacterium damselae subsp. piscicida plasmid pP91278, complete sequence
ATGGGAAAATACGTGCGTGAGACTATGAAAAAATCACCTTTGAATTTACTGCTCCTTGCAGCGCTCACGC
TGGGGGCATCACACCAGGCTTGGGCTCAAGATGGCACAAGACCTGGTTTTTATGAGCGAAAGGAAGAGGG
TTGGTTCTGGTACAAGGAAGAGCCCAAAGAACCAGAGAAAAAACCCGAAAAGCCCAAACCAAAGCCTGTG
GCAGAAGCGAAGCCTACACAGCCTAAGCCTGCTGCTCCGCTTCCGAGCGGCCCAGAAATGTTCTCAGCGG
AATGGTTCCGGGAAAACTTACCCAAGTACAAAGACCTTGCTTGGAACAATCCTACCGTTGAAAACGTCAG
GACGTTTCTCTACTTGCAACGATTTGCGATAGATCGCTCTGAACAATTTTCCGATGCTACAGAGCTGGCG
GTCGTAGGTGATCCTTTCTTGGATGAAATTACTCGACGTCCTGCTGCCACGTTTGCCTCACAACAAGTTG
ATCGTGACGCTGGTAACGCCAAAAACATGCTACTCAAAAGCGTAGCCGAACGCGTAGGGATATTCTTCTT
CTACAAGTCCGACGATGACTACAGTGACTTGCAAGCACCGCTCATCAAGATGTTGGAACAAGGAGAAGGA
TTCTCGATCATTCCTGTATCTATGGACGGCAAACCACTCCCCAGTGGGCTTTTCCCCCATTACAAAACCG
ATGAAGGCCATGCCAAACAACTTGGTATCGTAACTTTCCCTGCTGTTTACCTCGCATCTCCAGACGGTCA
GTTCGCTCCTATAGGACAAGGGCCAATGTCTCTTCCTGAGCTGAATCACAGGATTTTGGTCGCAGCAAAA
CGCAATGGTTGGGTCACAGACGAAGAGTTTAACCGTACACGTCCGGTACTCAACCTGGAAAACAACATAG
CCGAACGCTTGGCCTCACCAGAGCTGGGCTCTGACCTCAAACAGCTATCTCAAGCGAGCGGTGATAAAGA
CAACTTTGTGCCACCGGAACAACTCATGAAGTACATCCGGGACAAATTACAGGAGAACTAA
 Primer design