SecReT4
Protein ID: 118614686
T4SS name [ID]Tra_F [590]
Gene symbol-
Locus tagP99018ORF_058
StrainPhotobacterium damselae subsp. piscicida plasmid pP99-018 (NC_008612)
Repliconplasmid pP99-018 [GenBank: NC_008612] [Browse all T4SS(s) in this replicon]
Location [Strand]41230..41511 [+]
Productsex pilus assembly protein
Component typeTraL_F
UniProt IDA0PB00
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 3.4e-15, Aligned region: 4..80
Protein Sequence: 93 a.a.     [Download]
>gi|118614686|ref|YP_908469.1| sex pilus assembly protein [Photobacterium damselae subsp. piscicida]
MKPVKIPRRVDEPPHLLLWSADELAPMLLGLTIGVIIGKALICFLGGLLVTNLYRRFRDNHPDGYLLHMI
YWAGFIMTKAKSLKNPFVRRYLP
 
Nucleotide Sequence: 282 bp     [Download]
>gi|118614628|ref|NC_008612.1|:41230-41511 Photobacterium damselae subsp. piscicida plasmid pP99-018, complete sequence
ATGAAGCCTGTAAAGATACCGCGCCGGGTCGATGAGCCCCCGCATCTGCTGTTGTGGAGCGCAGATGAGT
TGGCCCCGATGCTTTTGGGGCTAACGATAGGGGTCATCATCGGTAAGGCCCTGATCTGCTTTCTGGGGGG
GTTACTTGTAACCAACCTTTATCGCCGATTCAGGGATAACCATCCGGATGGATACCTGCTCCACATGATC
TACTGGGCCGGGTTCATCATGACCAAGGCCAAATCTCTCAAGAATCCGTTTGTCCGGAGGTATTTGCCTT
GA
 Primer design