SecReT4
Protein ID: 118614755
T4SS name [ID]Tra_F [590]
Gene symbol-
Locus tagP99018ORF_127
StrainPhotobacterium damselae subsp. piscicida plasmid pP99-018 (NC_008612)
Repliconplasmid pP99-018 [GenBank: NC_008612] [Browse all T4SS(s) in this replicon]
Location [Strand]106276..107316 [+]
Productsex pilus assembly
Component typeTraF_F
UniProt IDA0PB69
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 4.1e-68, Aligned region: 47..276
Protein Sequence: 346 a.a.     [Download]
>gi|118614755|ref|YP_908538.1| sex pilus assembly [Photobacterium damselae subsp. piscicida]
MGKYVRETMKKSPLNLLLLAALTLGASHQAWAQDGTRPGFYERKEEGWFWYKEEPKEPEKKPEKPKPKPV
AEAKPTQPKPAAPLPSGPEMFSAEWFRENLPKYKDLAWNNPTVENVRTFLYLQRFAIDRSEQFSDATELA
VVGDPFLDEITRRPAATFASQQVDRDAGNAKNMLLKSVAERVGIFFFYKSDDDYSDLQAPLIKMLEQGEG
FSIIPVSMDGKPLPSGLFPHYKTDEGHAKQLGIVTFPAVYLASPDGQFAPIGQGPMSLPELNHRILVAAK
RNGWVTDEEFNRTRPVLNLENNIAERLASPELGSDLKQLSQASGDKDNFVPPEQLMKYIRDKLQEN
 
Nucleotide Sequence: 1041 bp     [Download]
>gi|118614628|ref|NC_008612.1|:106276-107316 Photobacterium damselae subsp. piscicida plasmid pP99-018, complete sequence
ATGGGAAAATACGTGCGTGAGACTATGAAAAAATCACCTTTGAATTTACTGCTCCTTGCAGCGCTCACGC
TGGGGGCATCACACCAGGCTTGGGCTCAAGATGGCACAAGACCTGGTTTTTATGAGCGAAAGGAAGAGGG
TTGGTTCTGGTACAAGGAAGAGCCCAAAGAACCAGAGAAAAAACCCGAAAAGCCCAAACCAAAGCCTGTG
GCAGAAGCGAAGCCTACACAGCCTAAGCCTGCTGCTCCGCTTCCGAGCGGCCCAGAAATGTTCTCAGCGG
AATGGTTCCGGGAAAACTTACCCAAGTACAAAGACCTTGCTTGGAACAATCCTACCGTTGAAAACGTCAG
GACGTTTCTCTACTTGCAACGATTTGCGATAGATCGCTCTGAACAATTTTCCGATGCTACAGAGCTGGCG
GTCGTAGGTGATCCTTTCTTGGATGAAATTACTCGACGTCCTGCTGCCACGTTTGCCTCACAACAAGTTG
ATCGTGACGCTGGTAACGCCAAAAACATGCTACTCAAAAGCGTAGCCGAACGCGTAGGGATATTCTTCTT
CTACAAGTCCGACGATGACTACAGTGACTTGCAAGCACCGCTCATCAAGATGTTGGAACAAGGAGAAGGA
TTCTCGATCATTCCTGTATCTATGGACGGCAAACCACTCCCCAGTGGGCTTTTCCCCCATTACAAAACCG
ATGAAGGCCATGCCAAACAACTTGGTATCGTAACTTTCCCTGCTGTTTACCTCGCATCTCCAGACGGTCA
GTTCGCTCCTATAGGACAAGGGCCAATGTCTCTTCCTGAGCTGAATCACAGGATTTTGGTCGCAGCAAAA
CGCAATGGTTGGGTCACAGACGAAGAGTTTAACCGTACACGTCCGGTACTCAACCTGGAAAACAACATAG
CCGAACGCTTGGCCTCACCAGAGCTGGGCTCTGACCTCAAACAGCTATCTCAAGCGAGCGGTGATAAAGA
CAACTTTGTGCCACCGGAACAACTCATGAAGTACATCCGGGACAAATTACAGGAGAACTAA
 Primer design