SecReT4
Protein ID: 119382893
T4SS name [ID]Trb [331]
Gene symbol-
Locus tagPden_0136
StrainParacoccus denitrificans PD1222
Repliconchromosome 1 [GenBank: NC_008686] [Browse all T4SS(s) in this replicon]
Location [Strand]121919..122851 [+]
Producthypothetical protein
Component typeTraF
UniProt IDA1AYA9
KEGG IDpde:Pden_0136
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 6.8e-51, Aligned region: 32..169
DUF736 [PF05284], Evalue: 1.9e-34, Aligned region: 203..305
Protein Sequence: 310 a.a.     [Download]
>gi|119382893|ref|YP_913949.1| unnamed protein product [Paracoccus denitrificans PD1222]
MTRRTRTAYLAATGLAVLVIGAVSVTEIAPRLIWNASASVPLGLYAVQPVGNLTLGDLVAVTLPEPLAQF
IVARGYVGPGVPLLKRVAALPGTRVCRRGSTITGDGQVLGEARERDRFGRPLPTWQGCRLIAEGEVFLMN
QDAEDSLDGRYFGPLPLGSVTARIVPLWTDAEDHGRFRRPAAGAETVPDPTTNHQPTESNMPQIGEFTRT
QSGYEGRIRTVTLDLQLVFVPTHADVENAPDYRLHLDGEDGPEIGAGWTHSGERAGTYISVALDDPVLAQ
PIRARLFQSDEQGRNWGLHWSRPRKRDERD
 
Nucleotide Sequence: 933 bp     [Download]
>gi|119382757|ref|NC_008686.1|:121919-122851 Paracoccus denitrificans PD1222 chromosome 1, complete sequence
ATGACCCGCAGGACCCGCACCGCCTATCTCGCTGCCACCGGCCTTGCCGTTCTGGTGATCGGTGCTGTTT
CCGTCACCGAGATCGCGCCCCGACTGATCTGGAACGCCTCCGCCAGCGTGCCGCTCGGGCTTTATGCCGT
TCAGCCCGTCGGCAATCTGACCCTCGGCGATCTGGTCGCGGTGACGCTGCCAGAACCGCTGGCGCAGTTC
ATCGTTGCGCGCGGCTATGTCGGCCCCGGCGTGCCGCTGCTGAAGCGCGTCGCCGCGCTTCCCGGCACCC
GGGTCTGCCGCAGAGGATCCACGATCACCGGCGACGGCCAGGTCCTCGGCGAGGCGCGCGAACGTGACCG
CTTCGGCCGGCCGCTGCCAACCTGGCAGGGCTGCCGGCTGATCGCTGAAGGCGAGGTGTTTCTCATGAAC
CAGGACGCGGAAGACAGTCTCGACGGCCGCTATTTCGGCCCGCTCCCGCTCGGCAGCGTCACCGCTCGCA
TCGTCCCGCTTTGGACCGATGCGGAGGACCACGGCCGCTTCCGCCGGCCTGCGGCCGGTGCGGAAACGGT
CCCTGATCCCACCACCAACCACCAGCCCACGGAGAGTAACATGCCACAGATCGGCGAATTCACCCGCACA
CAATCCGGATACGAGGGCCGCATCCGCACCGTCACGCTCGATCTGCAACTGGTCTTCGTGCCCACCCATG
CCGATGTCGAGAACGCCCCGGATTACCGGCTCCATCTCGACGGCGAGGACGGACCGGAGATCGGCGCCGG
CTGGACCCATAGTGGCGAAAGGGCCGGAACCTACATCTCGGTCGCCCTCGACGATCCCGTCCTCGCGCAG
CCGATCCGCGCCCGGCTGTTCCAGTCCGACGAGCAGGGCCGAAACTGGGGCCTGCACTGGTCGCGTCCCA
GAAAACGCGACGAGCGGGACTGA
 Primer design