SecReT4
Protein ID: 119382905
T4SS name [ID]Trb [331]
Gene symbol-
Locus tagPden_0148
StrainParacoccus denitrificans PD1222
Repliconchromosome 1 [GenBank: NC_008686] [Browse all T4SS(s) in this replicon]
Location [Strand]131779..132783 [-]
Productconjugal transfer protein TrbG/VirB9/CagX
Component typeTrbG
UniProt IDA1AYC1
KEGG IDpde:Pden_0148
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.6e-62, Aligned region: 96..315
Protein Sequence: 334 a.a.     [Download]
>gi|119382905|ref|YP_913961.1| unnamed protein product [Paracoccus denitrificans PD1222]
MIPITFRKPGPAIVLLFATMLAGCATQKSPQVSYDDHVPPLPSPPAAVADPAPKPLHVPPDWTPARGGNT
AESPIGRVANANLAARVEPRREGYYNAIQVYPWSEGALYQVYAAPGQITDIALEPGESLTGAGPIAAGDT
ARWIIGDTESGSGVFHRVHVLVKPTRPDISTNLVIATDRRRYMLELRASEEAWMPAVSWHYPESSAPAQR
RTVPAAPAIPGKASRNHRYGVQVQGASPPWRPVSVFDDGRRVYVVFPRGIAQGEMPPLFVIGPDGAPEIV
NSRVYGNVMIVDRLFGVAELRLGSGKRQQVVRIIRMEQTRAVAQPTRAPTKGSS
 
Nucleotide Sequence: 1005 bp     [Download]
>gi|119382757|ref|NC_008686.1|:c132783-131779 Paracoccus denitrificans PD1222 chromosome 1, complete sequence
ATGATCCCCATCACGTTCCGCAAACCCGGACCGGCCATTGTCCTGCTGTTCGCCACCATGCTGGCGGGCT
GCGCCACCCAGAAATCGCCGCAGGTCAGCTATGACGACCACGTGCCGCCGCTGCCTTCGCCGCCCGCTGC
CGTTGCCGATCCGGCACCAAAACCGTTGCATGTGCCGCCGGACTGGACACCGGCGCGCGGCGGCAATACG
GCGGAGAGCCCTATCGGTCGGGTGGCGAATGCCAATCTCGCCGCCCGGGTCGAGCCGCGCCGCGAGGGCT
ACTATAATGCCATACAGGTCTATCCGTGGAGCGAAGGCGCGCTCTATCAGGTCTATGCCGCGCCCGGACA
GATCACCGATATCGCGCTGGAGCCCGGCGAGAGTCTCACCGGCGCCGGCCCCATCGCCGCCGGCGACACC
GCCCGCTGGATCATCGGCGATACCGAGAGCGGCAGCGGCGTGTTCCACCGCGTGCATGTGCTGGTCAAGC
CGACACGGCCCGACATCAGTACTAACCTGGTCATCGCCACCGACCGGCGCCGCTACATGCTGGAGCTGCG
TGCGAGCGAGGAGGCCTGGATGCCGGCGGTGTCCTGGCACTATCCGGAATCGTCGGCACCGGCCCAACGG
CGAACGGTTCCCGCAGCACCGGCTATACCAGGCAAAGCATCCCGCAACCATCGCTACGGCGTGCAGGTGC
AAGGCGCGAGCCCACCCTGGCGGCCGGTCTCGGTCTTCGATGACGGCCGCCGGGTCTATGTGGTCTTTCC
GCGCGGCATCGCCCAGGGCGAGATGCCGCCGCTCTTCGTCATCGGCCCGGACGGTGCGCCCGAGATCGTC
AACAGCCGCGTCTACGGCAACGTCATGATCGTCGACCGGCTCTTCGGTGTGGCCGAGTTGCGGCTTGGGT
CCGGCAAGCGCCAGCAGGTGGTACGGATTATCCGTATGGAACAGACACGGGCGGTCGCCCAACCAACCCG
CGCGCCGACGAAAGGATCGTCCTGA
 Primer design