SecReT4
Protein ID: 119382907
T4SS name [ID]Trb [331]
Gene symbol-
Locus tagPden_0150
StrainParacoccus denitrificans PD1222
Repliconchromosome 1 [GenBank: NC_008686] [Browse all T4SS(s) in this replicon]
Location [Strand]133466..134785 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDA1AYC3
KEGG IDpde:Pden_0150
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2.8e-54, Aligned region: 37..262
Protein Sequence: 439 a.a.     [Download]
>gi|119382907|ref|YP_913963.1| unnamed protein product [Paracoccus denitrificans PD1222]
MGGSGVIDNFLAVFTSYIDSGFGLLGGEVAFIATTLIVIDVTLAALFWAWGAEDDILARLVKKTIFVGVF
AWLITNWNSLARIVFDSFAGLGLMASGTGFTAADLMRPGRVAQTGLDAGRPLLESISDLMGWVAVFENLI
QILCLFFAWALVILAFFILAVQLFVTLIEFKLTTLAGFVLIPFGLFGKTAFMAERVLGNVVSSGIKVLVL
AVIIGIGSTLFSQFTTGFGGVAPTVDDAMAIVLAALSLLGLGIFGPGIANGLVSGGPQLGAGAAVGTGLA
VGGAALVAGGATVLGAKGGAMAARGGAATAGAASAAYTLHSAGESGLGGALSGVAGIGKGAGIAALSPLR
KAAASISKSHAAGVKTAFTGTGGSTTQGTLGGVGASVPTPSSPGSPPAWAQRLRGQAVGRGATVAAHAVR
SGDSHGPGASVSLSESDKP
 
Nucleotide Sequence: 1320 bp     [Download]
>gi|119382757|ref|NC_008686.1|:c134785-133466 Paracoccus denitrificans PD1222 chromosome 1, complete sequence
ATGGGCGGATCCGGCGTCATCGACAATTTCCTGGCGGTCTTCACCAGCTATATCGACAGCGGCTTCGGTC
TTCTGGGCGGCGAGGTCGCCTTCATCGCCACCACGCTGATCGTCATCGACGTGACGCTGGCCGCCCTGTT
CTGGGCCTGGGGCGCCGAGGACGATATTCTGGCCCGGCTGGTGAAGAAGACCATCTTCGTCGGCGTCTTC
GCCTGGCTGATCACCAACTGGAACAGTCTCGCGCGCATCGTCTTCGACAGTTTCGCCGGTCTCGGGCTCA
TGGCCTCCGGCACCGGCTTCACCGCCGCCGATCTCATGCGCCCCGGCCGCGTCGCCCAGACCGGGCTCGA
TGCCGGACGGCCGCTCCTGGAATCCATCTCCGACCTGATGGGCTGGGTCGCGGTGTTCGAGAACCTGATC
CAGATCCTCTGCCTGTTCTTCGCCTGGGCGCTGGTGATCCTCGCCTTCTTCATCCTCGCCGTGCAGCTCT
TCGTCACCCTGATCGAGTTCAAGCTGACCACGCTCGCGGGCTTCGTGCTGATCCCCTTCGGGCTTTTCGG
CAAGACCGCCTTCATGGCCGAGCGCGTGCTGGGCAATGTCGTCTCCAGCGGTATCAAGGTTCTCGTGCTA
GCCGTCATCATCGGCATCGGCAGCACCTTGTTTTCGCAGTTCACCACCGGCTTTGGAGGCGTCGCGCCCA
CCGTGGACGACGCCATGGCCATCGTGCTGGCGGCGCTGTCGCTCTTGGGCCTCGGCATCTTCGGCCCCGG
CATCGCCAACGGGCTCGTCTCCGGAGGTCCGCAGCTTGGCGCGGGTGCCGCCGTCGGCACCGGGCTGGCC
GTAGGGGGTGCCGCGCTCGTCGCCGGTGGGGCGACCGTGCTGGGGGCGAAGGGTGGTGCGATGGCCGCAC
GCGGCGGAGCCGCGACGGCGGGCGCCGCCTCCGCTGCCTACACCCTCCATTCCGCCGGAGAATCCGGGCT
CGGTGGTGCCCTCTCCGGTGTCGCCGGTATCGGCAAAGGTGCCGGCATCGCCGCGCTGTCGCCGCTGCGC
AAAGCGGCGGCCAGCATCTCCAAGAGCCATGCCGCCGGAGTGAAGACCGCCTTCACCGGCACTGGCGGAT
CCACCACGCAGGGAACGCTCGGCGGCGTCGGTGCATCTGTGCCCACTCCGTCATCTCCCGGCAGCCCGCC
CGCCTGGGCGCAGCGCCTGCGCGGGCAAGCCGTGGGCCGGGGCGCAACCGTCGCCGCCCATGCGGTCCGG
TCAGGTGACAGCCATGGTCCCGGTGCTTCCGTTTCCCTTTCCGAAAGCGACAAGCCATGA
 Primer design