SecReT4
Protein ID: 119382912
T4SS name [ID]Trb [331]
Gene symbol-
Locus tagPden_0155
StrainParacoccus denitrificans PD1222
Repliconchromosome 1 [GenBank: NC_008686] [Browse all T4SS(s) in this replicon]
Location [Strand]138809..139138 [-]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDA1AYC8
KEGG IDpde:Pden_0155
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.8e-23, Aligned region: 6..99
Protein Sequence: 109 a.a.     [Download]
>gi|119382912|ref|YP_913968.1| unnamed protein product [Paracoccus denitrificans PD1222]
MIHALRIRHHVAIAAIFVWTSLVLAPTAHAAGSSMPWEAPLQSILDSVEGPVAKIVAVIIIIVTGLTLAF
GDTGGGFRRLIQIVFGISIAFAASSFFLSFFSFGGGALV
 
Nucleotide Sequence: 330 bp     [Download]
>gi|119382757|ref|NC_008686.1|:c139138-138809 Paracoccus denitrificans PD1222 chromosome 1, complete sequence
ATGATCCATGCCCTCCGCATCCGTCATCATGTCGCAATCGCCGCCATATTCGTCTGGACCAGCCTCGTCC
TTGCACCGACTGCCCATGCCGCCGGCTCCTCGATGCCTTGGGAGGCGCCGCTGCAATCCATCCTCGATTC
CGTCGAGGGGCCGGTGGCCAAGATCGTCGCGGTGATCATCATCATCGTCACCGGGCTGACCCTGGCCTTC
GGCGATACCGGCGGCGGCTTCCGCCGGCTGATCCAGATCGTCTTCGGCATCTCCATCGCCTTCGCGGCCA
GTTCGTTCTTCTTGTCGTTCTTCAGCTTCGGCGGCGGGGCGCTGGTCTGA
 Primer design