SecReT4
Protein ID: 119384216
T4SS name [ID]Trb [332]
Gene symbol-
Locus tagPden_1476
StrainParacoccus denitrificans PD1222
Repliconchromosome 1 [GenBank: NC_008686] [Browse all T4SS(s) in this replicon]
Location [Strand]1437617..1438645 [-]
Productconjugal transfer protein TrbG/VirB9/CagX
Component typeTrbG
UniProt IDA1B232
KEGG IDpde:Pden_1476
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 3.1e-60, Aligned region: 104..322
Protein Sequence: 342 a.a.     [Download]
>gi|119384216|ref|YP_915272.1| unnamed protein product [Paracoccus denitrificans PD1222]
MTEQHLHATRSPGVNKPTLVALLLCASFLAGCATNRVPEFSYDESVPPLPTPPASAAAERPWPLHTPPVW
TVAHGGAAAGTPTGRIENANAAARIEPRREGYYNAIQIYPWSEGALYQVYAAPGQITNIALEPGERLTGA
GPIAAGDTTRWIIGDTESGSGSTARVHILVKPTRDDISTNLVISTDRRVYTIELRAREALYMPSVAWAYP
AAPRGGRQAVATAPTIPAPSARNHRYSLQIQGESPPWRPVSVFDDGRRVYVVFPAGIAQGEMPPLFVLGA
DGEPQIVNSRIHRNVLIVDRLFGAAELRLGAGDRQQVIRIVRMEEREADARTEGDARRGGAS
 
Nucleotide Sequence: 1029 bp     [Download]
>gi|119382757|ref|NC_008686.1|:c1438645-1437617 Paracoccus denitrificans PD1222 chromosome 1, complete sequence
ATGACTGAACAGCATCTGCATGCAACCAGGTCTCCGGGCGTCAACAAGCCCACCTTGGTGGCCTTGCTGC
TTTGCGCATCCTTTCTGGCGGGGTGTGCCACTAACCGGGTGCCGGAATTCAGCTACGACGAGTCCGTGCC
GCCGCTGCCCACTCCGCCCGCCTCGGCTGCCGCGGAACGTCCTTGGCCCCTGCATACGCCGCCGGTCTGG
ACAGTGGCGCATGGCGGAGCGGCGGCAGGCACACCGACCGGCCGTATTGAAAACGCCAATGCCGCCGCCC
GGATCGAACCGCGCCGCGAGGGCTATTACAATGCGATCCAGATCTATCCCTGGTCGGAAGGCGCCCTCTA
TCAGGTCTATGCCGCGCCGGGTCAGATCACCAACATCGCATTGGAGCCGGGCGAGCGCCTGACCGGCGCG
GGCCCGATCGCCGCGGGGGATACCACGCGCTGGATCATCGGCGACACGGAGAGCGGGTCCGGATCCACCG
CCCGCGTCCACATCCTCGTCAAACCGACGCGGGACGACATCTCGACCAATCTGGTGATCAGCACTGACAG
GCGGGTGTACACGATCGAGCTTCGTGCACGCGAGGCGCTCTACATGCCGTCGGTCGCCTGGGCCTATCCG
GCAGCGCCCCGTGGCGGTCGACAAGCTGTGGCGACCGCGCCGACCATCCCGGCACCATCGGCCCGCAATC
ATCGCTACAGCTTGCAGATCCAGGGGGAAAGCCCACCCTGGCGTCCTGTCTCGGTCTTCGACGATGGCCG
TCGTGTTTATGTCGTCTTCCCGGCTGGCATCGCCCAGGGCGAGATGCCGCCGCTCTTCGTGCTCGGTGCC
GATGGAGAACCGCAGATCGTCAACAGCCGTATCCACCGGAACGTGCTGATCGTGGATCGCCTCTTCGGCG
CCGCCGAGCTCCGGCTGGGAGCAGGAGACCGCCAGCAGGTGATCCGGATCGTGCGCATGGAGGAGCGCGA
GGCGGATGCGCGGACGGAGGGCGATGCGCGAAGGGGAGGGGCGTCATGA
 Primer design