SecReT4
Protein ID: 119384218
T4SS name [ID]Trb [332]
Gene symbol-
Locus tagPden_1478
StrainParacoccus denitrificans PD1222
Repliconchromosome 1 [GenBank: NC_008686] [Browse all T4SS(s) in this replicon]
Location [Strand]1439328..1440680 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDA1B234
KEGG IDpde:Pden_1478
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 9.2e-54, Aligned region: 37..262
Protein Sequence: 450 a.a.     [Download]
>gi|119384218|ref|YP_915274.1| unnamed protein product [Paracoccus denitrificans PD1222]
MGGTGVIDNFLGIFTSYIDSGFGLLGGEVAFIATTLIVIDVTLAALFWAWGADDDIIARLVKKTLFVGVF
AYIISNWNNLARIVFESFAGLGLMASGTGFSAADLLRPGRVAQTGLEAGRPLLESISDLMGWVAVFENLV
QILCLFFAWALVILAFFILAVQLFVTLIEFKLTTLAGFVLIPFGLFGKTAFMAERVLGNVISSGIKVLVL
AVIIGIGSTLFGQFTAGFGGVTPTIDDAMAIVLAALSLLGLGIFGPGIASGLVSGGPQLSAGAAIGTGLA
VGGAAIGAGGATMLAARGAGSALSGGTALARGGATAAGAASSAYTLGSMGGGGLPGGMAGVARAGAAAAA
SPLKKASSRAAGGIQSSYAEGVKGGVVATGGTTSMGTVGGAAPEPGSSGPSATDGPPAWAKRMRHSQAVS
HGVRAAAHAVRSGDSHGSGSSVNLSERDRS
 
Nucleotide Sequence: 1353 bp     [Download]
>gi|119382757|ref|NC_008686.1|:c1440680-1439328 Paracoccus denitrificans PD1222 chromosome 1, complete sequence
ATGGGTGGAACCGGCGTCATCGACAACTTTCTGGGCATCTTCACCAGCTATATCGACAGCGGGTTCGGGC
TGCTCGGGGGTGAGGTGGCCTTCATCGCCACCACGCTGATCGTGATCGACGTGACGCTGGCGGCCCTGTT
CTGGGCTTGGGGCGCCGATGATGACATCATTGCCCGGCTGGTGAAGAAGACGCTCTTCGTCGGCGTCTTC
GCCTATATCATCTCCAACTGGAACAACCTCGCCCGGATTGTCTTCGAGAGCTTCGCGGGCCTCGGTCTGA
TGGCCTCGGGCACCGGATTTTCCGCCGCCGATCTTTTGCGTCCCGGCCGCGTCGCCCAGACCGGGCTCGA
GGCGGGGCGGCCGCTGCTCGAAAGCATCTCCGATCTGATGGGCTGGGTCGCGGTCTTTGAGAACCTCGTC
CAGATTCTCTGCCTGTTCTTCGCCTGGGCGCTGGTGATCCTCGCCTTCTTCATCCTCGCGGTTCAGCTCT
TCGTCACACTGATCGAGTTCAAGCTCACGACCCTCGCGGGCTTCGTGCTGATCCCCTTCGGCCTCTTCGG
CAAGACCGCCTTCATGGCCGAGCGCGTGCTGGGCAACGTCATCTCGTCCGGCATCAAGGTTCTCGTCCTC
GCCGTGATCATCGGCATCGGATCCACGCTCTTCGGTCAGTTCACCGCCGGCTTCGGCGGCGTGACGCCGA
CCATTGATGACGCCATGGCGATTGTTCTCGCTGCCCTGTCTCTGCTGGGCCTCGGTATCTTCGGCCCCGG
CATCGCCTCAGGTCTGGTGTCCGGCGGGCCGCAACTCAGCGCGGGGGCGGCCATAGGCACCGGCCTTGCC
GTTGGTGGTGCTGCGATCGGCGCCGGAGGGGCGACCATGCTGGCTGCACGCGGAGCCGGATCTGCACTCT
CCGGAGGCACCGCCCTCGCACGCGGCGGCGCTACCGCGGCGGGTGCTGCCTCGAGCGCCTACACGCTTGG
CTCGATGGGCGGAGGAGGTCTCCCAGGCGGGATGGCTGGTGTAGCGCGCGCCGGGGCCGCTGCCGCGGCA
TCACCGCTCAAGAAGGCGTCCTCTCGCGCGGCTGGCGGCATCCAGTCCAGCTACGCCGAGGGCGTCAAGG
GCGGTGTGGTGGCGACGGGCGGCACCACCTCGATGGGCACGGTCGGCGGCGCGGCGCCCGAGCCTGGCAG
CTCCGGCCCGTCCGCCACCGATGGCCCGCCGGCCTGGGCGAAACGCATGCGCCATAGCCAGGCCGTGAGC
CATGGCGTGCGCGCTGCCGCTCATGCCGTCCGGTCCGGCGACAGCCACGGCTCGGGCTCCTCCGTCAATC
TCTCCGAAAGGGACCGCTCATGA
 Primer design